Recombinant Human C-X-C Motif Chemokine 9 (CXCL9) Protein (His&Myc)

Name: Recombinant Human C-X-C Motif Chemokine 9 (CXCL9) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-08020P
Price: 418.4 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Chemokines and receptors, Cytokines, Cytokines and growth factors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-X-C Motif Chemokine 9 (CXCL9) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q07325
Target Symbol	CXCL9
Synonyms	C-X-C motif chemokine 9; chemokine (C-X-C motif) ligand 9; CMK; crg-10; CXCL9; CXCL9_HUMAN; gamma interferon induced monokine; Gamma-interferon-induced monokine; HuMIG; MIG; monokine induced by gamma interferon; monokine induced by interferon gamma; Monokine induced by interferon-gamma; SCYB9; Small inducible cytokine B9; small inducible cytokine subfamily B member 9; Small-inducible cytokine B9
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Expression Range	23-125aa
Protein Length	Full Length of Mature Protein
Mol. Weight	16.7 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
Subcellular Location	Secreted.
Protein Families	Intercrine alpha (chemokine CxC) family
Database References	HGNC: 7098 OMIM: 601704 KEGG: hsa:4283 STRING: 9606.ENSP00000354901 UniGene: Hs.77367

Gene Functions References

CXC chemokine ligand 9 promotes the progression of diffuse large B-cell lymphoma in a beta-catenin-dependent manner. PMID: 30130730
CXCL9 level was significantly higher in alopecia areata patients compared with controls and with vitiligo patients PMID: 27863059
CXCL9 may promote prostate cancer progression via inhibition of cytokines from T cells. PMID: 29901197
High CXCL9 expression is associated with invasion and metastasis in tongue squamous cell carcinoma. PMID: 29286143
MIG low in the tumor microenvironment can be used as potential indicators for the progression of non-small cell lung cancer PMID: 28375674
the results of the current study revealed increased serum levels of MIG as a novel independent marker of poor prognosis in newly diagnosed patients with MM. PMID: 26999330
High CXCL9 expression is associated with clear-cell renal cell carcinoma. PMID: 26910919
Circulating CXCL9 serum levels are high in chronic Q fever patients and is a promising biomarker for the diagnosis of chronic Q fever. PMID: 28793883
High urine CXCL9 level is associated with acute rejection in Histologically Stable Kidney transplant Recipients. PMID: 26694099
CXCL9 expression in lesional macrophages implicates the skin as the source of circulating cytokines. CXCL9 is a promising biomarker of disease activity in morphea. PMID: 28450066
significant correlation between serum levels and the severity of coronary artery disease, quantified by the Gensini score PMID: 28100872
High CXCL9 plasma levels favour response to pegIFN alpha 2a and ribavirin in hepatitis C virus infected patients regardless of DPP4 activity. PMID: 26344576
CXCL9 is a useful predictor of better clinical outcome in colorectal cancer patients. PMID: 26898419
The mRNA expression and serum levels of CXCL9 were both increased. PMID: 26828996
Data show that asymptomatic patients with unstable plaques exhibited higher levels of endothelial microparticles (EMPs), CXCL9 chemokine and stem cell growth factor; lymphocyte secreted C-type lectin (SCGF-beta) compared to those with stable plaques. PMID: 26564003
congruent with the concept that inflammation plays a key role in the pathogenesis of LV dysfunction, MIG, IP10 and I-TAC add diagnostic accuracy over and beyond NT-pro BNP. PMID: 26506526
Suggest that CD44 and CXCL9 may serve as predictive biomarkers to identify liver allograft recipients at risk for clinically significant acute graft rejection. PMID: 25950774
Knock-down of CD44 resulted in an upregulation of mRNA expression of the chemokines CXCL9 and CXCL12, as well as their receptors CXCR3 and CXCR4. PMID: 24614402
There were no significant differences in distribution of CXCL9 genotypes and alleles between rheumatoid arthritis patients and control group. PMID: 25702175
This work confirms that OPN, CCL5 and CXCL9 plasma levels are higher in psoriasis patients and provides evidence that their higher levels are not a consequence of obesity. PMID: 25972108
This inhibitory action of resveratrol was also observed for the cytokines-induced expression of chemokines CXCL9, CCL2 and CCL5. PMID: 25890876
This paper suggests a role for Epithelial to mesenchymal cell transition in the pathogenesis of idiopathic pulmonary fibrosis and provides a novel mechanism for the inhibitory effects of CXCL9 on TGF-beta1-induced Epithelial to mesenchymal cell transition. PMID: 26268659
The expression of TNF-alpha and CXCL9 in blood samples stimulated with a bacterial antigen distinguishes active tuberculosis patients from latent disease carriers and healthy controls. PMID: 25528189
CXCL9 inhibits the proliferation of epithelial cells via phosphorylation of p70S6K, resulting in the excretion of TGF-beta as downstream mediator. CXCL9/CXCR3 interaction can exacerbate antineoplastic agent-induced intestinal damage. PMID: 25398650
CXCL9 is involved in the invasion ability of hepatocellular carcinoma cells possibly through up-regulation of its potential effector PREX2. PMID: 25151370
both bactericidal and cell-recruiting activities of MIG/CXCL9 are corrupted by P. aeruginosa through release of elastase, and this may contribute to impaired airway host defense in CF. PMID: 25115612
Elevated IL-2R, IL-1RA, and CXCL9 are associated with shorter event-free survival in newly diagnosed follicular lymphoma, treated with chemoimmunotherapy. PMID: 25422100
CXCL9 expression was low in control skin, mild in perilesional skin from slowly progressive vitiligo and high in progressive vitiligo. Such expression was found in the epidermal as well as the dermal infiltrate. PMID: 24438589
study demonstrated that CXCL9 is associated with tumor burden and aggressiveness of NPC tumors and the serum level of this ligand may be useful as a prognostic indicator PMID: 24278236
Higher circulating levels of CXCL-9 and -11 have been shown in non-pregnant autoimmune thyroiditis patients with a history of recurrent abortion as compared to both control groups PMID: 24351073
In this study of human cryoglobulinemic glomerulonephritis we showed a striking expression of cytokine CXCL9, a classical macrophage activation marker, by the macrophages and possibly other cell types within the glomeruli. PMID: 24084359
High urinary CXCL9 is associated with kidney transplant injury. PMID: 23968332
CXCL9 associated with sustained virological response in chronic hepatitis B patients receiving peginterferon alfa-2a therapy. PMID: 24124595
Plasma concentrations of CXCL9 are elevated at the onset of chronic graft-versus-host disease diagnosis, but not in patients with chronic graft-versus-host disease for more than 3 months. PMID: 24363401
Collectively, our results show that a diverse milieu of chemokines is expressed in myocardium and valvular tissue lesions and emphasize the role of CXCL9/Mig in mediating T cell recruitment to the site of inflammation in the heart. PMID: 23417848
Our study demonstrated that CXCL9 is associated with tumor burden and aggressiveness of OSCC tumors and serum level of this ligand may be useful as a prognostic indicator PMID: 23769451
CXCL9 was increased in lung transplant lavage fluid during diffuse alveolar damage, acute rejection, and lymphocytic bronchiolitis. Elevated CXCL9 was associated with increased risk of chronic allograft dysfunction. PMID: 24063316
Our study demonstrates in mixed cryoglobulinemia and hepatitis C vs controls: (i)high serum CXCL9 and CXCL11, significantly associated with the presence of active vasculitis; (ii) a strong relationship between circulating CXCL9 and CXCL11 PMID: 23527708
The secretion of CXCL9 by activated T cells is also increasingly downregulated with increasing concentrations of bortezomib. PMID: 23179902
Report high serum levels of CXCL9/TNF-alpha/interferon-gamma in patients with mixed cryoglobulinaemia and chronic hepatitis C. PMID: 22766105
Intragraft CXCL9 mRNA has a functionally important role in T-cell activation in liver allograft and serves as biomarker for acute cellular rejection. PMID: 22889476
CXCL9 is localized predominantly in the cytoplasm of breast cancer cells and prostaglandin E2 inhibits cytokine induced CXCL9 secretion. PMID: 22333315
Malaria-infected primigravidae with placental CXCL9 levels in the lowest tertile gave birth to babies who weighed 610 g more than babies born to mothers with high CXCL9 levels. PMID: 22689822
Elevated plasma levels of MIG are associated with inflammatory bowel disease with JCV infection. PMID: 22467521
HSV-2 induces CXCL9 expression in human cervical epithelial cells by activation of p38-C/EBP-beta pathway PMID: 22586042
Autophagy may be a crucial intracellular mechanism of Mig induction in response to HBV infection. PMID: 22580676
Immunohistochemically, the lining synovium of Rheumatoid Aarthritis clearly expressed CXCL9 PMID: 22401175
Elevated plasma levels of interferon-gamma and Cys-X-Cys chemokine receptor 3-binding chemokine CXCL9 are present in patients with thoracic aortic aneurysms. PMID: 21962843
We found that urine CXCL9 and CXCL10 were markedly elevated in adults and children experiencing either AR or BKI (p = 0.0002), but not in stable allograft recipients PMID: 21812928
We first show that circulating CXCL9 and CXCL11 are increased in patients with thyroiditis and hypothyroidism and are related to each other. PMID: 21470996

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.