Recombinant Human C-X-C Motif Chemokine 5 (CXCL5) Protein (His)
Recombinant Human C-X-C Motif Chemokine 5 (CXCL5) Protein (His)
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Celebrate thanksgiving with 30% off all beta lifescience products!, Chemokines and receptors – essential regulators of immune response, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins, Recombinant transmembrane proteins
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human C-X-C Motif Chemokine 5 (CXCL5) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P42830 |
| Target Symbol | CXCL5 |
| Synonyms | AMCFII; C-X-C motif chemokine 5; C-X-C motif chemokine ligand 5; Chemokine (C X C motif) ligand 5; chemokine (C-X-C motif) ligand 5; Cxcl5; CXCL5_HUMAN; ENA 78; ENA-78 (8-78); ENA-78(1-78); ENA-78(9-78); ENA78; Epithelial derived neutrophil activating protein 78; Epithelial-derived neutrophil-activating protein 78; Lipopolysaccharide-induced CXC chemokine; Neutrophil activating peptide ENA 78 ; Neutrophil activating protein 78; Neutrophil-activating peptide ENA-78; neutrophil-activating protein 78; SCYB5; Small inducible cytokine B5 ; small inducible cytokine subfamily B (Cys-X-Cys); member 5 (epithelial-derived neutrophil-activating peptide 78); small inducible cytokine subfamily B; member 5; Small-inducible cytokine B5 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG |
| Expression Range | 37-110aa |
| Protein Length | Partial |
| Mol. Weight | 11.9kDa |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. |
| Subcellular Location | Secreted. |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Database References | HGNC: 10642 OMIM: 600324 KEGG: hsa:6374 STRING: 9606.ENSP00000296027 UniGene: PMID: 27501402 |

