Recombinant Human C-X-C Motif Chemokine 5 (CXCL5) Protein (GST)

Name: Recombinant Human C-X-C Motif Chemokine 5 (CXCL5) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-11154P
Price: 418.4 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Chemokines and receptors, Cytokines, Cytokines and growth factors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-X-C Motif Chemokine 5 (CXCL5) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P42830
Target Symbol	CXCL5
Synonyms	AMCFII; C-X-C motif chemokine 5; C-X-C motif chemokine ligand 5; Chemokine (C X C motif) ligand 5; chemokine (C-X-C motif) ligand 5; Cxcl5; CXCL5_HUMAN; ENA 78; ENA-78 (8-78); ENA-78(1-78); ENA-78(9-78); ENA78; Epithelial derived neutrophil activating protein 78; Epithelial-derived neutrophil-activating protein 78; Lipopolysaccharide-induced CXC chemokine; Neutrophil activating peptide ENA 78 ; Neutrophil activating protein 78; Neutrophil-activating peptide ENA-78; neutrophil-activating protein 78; SCYB5; Small inducible cytokine B5 ; small inducible cytokine subfamily B (Cys-X-Cys); member 5 (epithelial-derived neutrophil-activating peptide 78); small inducible cytokine subfamily B; member 5; Small-inducible cytokine B5
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG
Expression Range	37-110aa
Protein Length	Partial
Mol. Weight	34.9kDa
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.
Subcellular Location	Secreted.
Protein Families	Intercrine alpha (chemokine CxC) family
Database References	HGNC: 10642 OMIM: 600324 KEGG: hsa:6374 STRING: 9606.ENSP00000296027 UniGene: Hs.89714

Gene Functions References

Serum CXCL5 levels from pemphigus vulgaris patients are significantly higher than those in bullous pemphigoid patients and healthy controls. PMID: 27501402
These data demonstrated that CXCL5 expression was upregulated in prostate cancer tissues and that exogenous CXCL5 protein exposure or CXCL5 overexpression promoted malignant phenotypes of prostate cancer cells in vitro and in vivo. PMID: 29749439
activated CXCL5-CXCR2 axis contributes to the metastatic phenotype of PTC cells by modulating Akt/GSK-3beta/beta-catenin pathway PMID: 29471001
study elucidates the important role of CXCL5 in the progression and prognosis of NSCLC. These findings suggested that CXCL5 might be a potential biomarker and novel therapeutic target for lung cancer PMID: 29526026
PERK-p-eIF2alpha pathway could suppress metastasis in triple-negative breast cancer by inhibiting expression of PDL1 and CXCL5 in tumor cells. PMID: 29053414
Mechanistically, AR modulated cytokine CXCL5 expression by altering AKT --> NF-kappaB signaling, and interruption of AKT --> NF-kappaB --> CXCL5 signaling using either specific inhibitors or siRNA suppressed AR-enhanced EC recruitment and AR-EC-promoted RCC progression. PMID: 27848972
Curcumin suppressed CXCL5 expression by direct inhibition of IKKbeta phosphorylation, and inhibition of p38 MAPK via induction of negative regulator MKP-1. PMID: 27538525
The CXCL5 and the overexpression of miR-141 reduced levels of MMP-2 and MMP-9 in tumor necrosis factor-alpha-treated HT29 cells by means of repressing the inhibitory AKT. PMID: 28854064
CXCL5 may promote mitomycin resistance by activating EMT and NF-kappaB pathway. Thus, this study identifies CXCL5 as a novel chemoresistance-related marker in non-muscle invasive bladder cancer PMID: 29545183
findings for the first time provided evidence that ENA78 may play a key role of mediator in pathogenesis of Major Depressive Disorder(MDD) and in the mechanism of vinlafaxine effects on MDD. PMID: 28441588
our findings support CXCL5 as a promoter of colorectal cancer metastasis and a predictor of poor clinical outcomes in colorectal cancer patients. PMID: 28356111
CXCL5 levels were decreased in LSCC patient serum. PMID: 27876461
a finely tuned balance between the GAG-bound dimer and free soluble monomer regulates CXCL5-mediated receptor signaling and function. PMID: 27471273
CXCL5 plays a promoting role in glioma in autocrine- and paracrine-dependent manners. PMID: 27748886
The expression of CXCL5 is up-regulated in osteosarcoma cells. PMID: 28277189
CXCL5 expression in urine is related to bladder cancer TNM stage, lymph node metastasis, tumor size, and tumor grade. PMID: 26503215
ENA 78 plasma levels were correlated with Expanded Disability Status Scale scores in neuromyelitis optica (NMO) patients; elevated secretion of ENA 78 may be a critical step in neutrophil recruitment during the remission of NMO. PMID: 27401736
CXCL5 expression is enriched in human atherosclerotic coronary artery. The CXCL5 variant might be a genetic risk factor for the susceptibility of CAD and the CXCL5 promoter -156 G/C C allele might be an independent predictor for CAD. PMID: 26287498
Study shows that CXCL5 expression is elevated in positive correlation to bladder cancer grade and promotes cell migration and invasion via binding to its receptor CXCR2. PMID: 26058729
Analysis of monocultured dermal fibroblasts and keratinocytes revealed that only fibroblasts but not keratinocytes displayed up regulated CXCL5 levels after UV stimulation. PMID: 25690483
There was an inverse correlation between DACH1 mRNA levels and CXCL5 in both lung cancer cell lines and human NSCLC tissues. PMID: 25788272
High CXCL5 expression is associated with pediatric ulcerative colitis. PMID: 25738378
the increased level of CXCL5 in tissue compartments, including the central nervous system of HIV-1-infected individuals might alter the inflammatory response through the infiltration of neutrophils into tissue compartment PMID: 25536401
Serum levels of ENA-78 were elevated in autistic children and they were significantly associated with the increased levels of serum antineuronal auto-antibodies PMID: 25871636
This study aims to evaluate serum levels of ENA78/CXCL5 and SDF-1/CXCL12 along the gastric cancer carcinogenesis, and analyze their clinical significance, and diagnostic potentials through human serum samples. PMID: 25689618
our data showed that the CXCR2/CXCL5 axis contributes to EMT of HCC cells through activating PI3K/Akt/GSK-3beta/Snail signaling, and it may serve as a potential therapeutic target. PMID: 25462858
Solution structure of CXCL5--a novel chemokine and adipokine implicated in inflammation and obesity PMID: 24695525
the expression levels of CXCL5 proteins were decreased in dermal blood vessels of early stage diffuse cutaneous systemic sclerosis PMID: 24292093
data indicates that LCCs per se may act as the producer and receptor of CXCL5 responsible for liver cancer migration and invasion PMID: 25011526
Citrullinated ENA-78/CXCL5 is highly correlated with rheumatoid arthritis disease activity and, unlike noncitrullinated ENA-78/CXCL5, recruits monocytes. PMID: 24943990
CXCL5 showed a statistically significant prognostic effect PMID: 24500664
mRNA and protein of CXCL5 is increased in bladder tumor tissues and cell lines; down-regulation of CXCL5 resulted in significantly decreased cell proliferation, migration and increased cell apoptosis through Snail, PI3K-AKT and ERK1/2 signaling pathways. PMID: 24583128
Knockdown of HSP27 by shRNA decreased HB-EGF plus CXCL5-mediated tumor spheroid formation in a three-dimensional culture system, suggesting that AKT/HSP27 was required for HB-EGF/CXCL5-mediated cancer progression PMID: 24346967
Liver cancer cells with high metastatic potential have a higher expression of CXCL5. Exogenous CXCL5 can increase the proliferation, migration and invasion of liver cancer cells with low metastatic potential. PMID: 23290114
sCXCL5 level was determined to be an independent prognostic factor for NPC patients PMID: 23469080
Increased levels of CXCL5 contribute to enhanced levels of RANKL expression in Paget's disease of bone. PMID: 23439434
CXCL5 gene polymorphisms are functional and associated with variable blood pressure in cardiovascular disease-free individuals. PMID: 23245743
CXCL5 promotes HCC cell proliferation, invasion, and intratumoral neutrophil infiltration. PMID: 22711685
Preoperative serum CXCL5 could serve as a novel predictive marker for prognosis determination of colorectal cancer patients. PMID: 22197219
Endothelial production of both ENA-78 and IL-8 was induced by the proinflammatory cytokine IL-1beta. PMID: 22274300
Serum CXC ligand 5 is a new marker of subclinical atherosclerosis in type 2 diabetes. PMID: 21609350
Blockade of CXCL5 can modulate IL-17-induced arthritic inflammation in part by reducing joint blood vessel formation through a non-overlapping IL-17 mechanism. PMID: 21779896
Data demonstrate that the chemokine CXCL5 is a peripheral mediator of UVB-induced inflammatory pain, likely in humans as well as rats. PMID: 21734176
Plasma CXCL5 levels are lower in patients with chronic liver disease, suggesting that CXCL5 might be involved in the pathogenesis of chronic liver disease. PMID: 21332547
CXCL5/ENA78 increased cell migration and epithelial-to-mesenchymal transition of hormone-independent prostate cancer by early growth response-1/snail signaling pathway. PMID: 20945384
Report influence of troglitazone, sodium butyrate, 5-aminosalicylic acid and BAY 11-7082 on the chemokine ENA-78/CXCL5 secretion in the intestinal subepithelial myofibroblasts. PMID: 21229889
CD14 and CXCL5 were both expressed in tunica intima and tunica adventitia of adipose tissue blood vessels; CXCL5 exhibited chemoattractant and angiogenic properties. PMID: 21034724
The highly divergent effects of modifications of CXCL5 on neutrophil influx underline the potential importance of tissue-specific interactions between chemokines and PAD or proteases. PMID: 20630876
expression in gingival epithelial cells is induced by thrombin via activation of protease-activated receptor 1 PMID: 19567485
Elevated circulating CXCL5 concentrations were associated with higher risk of hypercholesterolemia in middle-aged and elderly Chinese independent of obesity, inflammation, adipokines, and other risk factors but not insulin resistance. PMID: 20501684

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.