Recombinant Human C-X-C Motif Chemokine 3 (CXCL3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08354P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human C-X-C Motif Chemokine 3 (CXCL3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08354P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human C-X-C Motif Chemokine 3 (CXCL3) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P19876 |
Target Symbol | CXCL3 |
Synonyms | C-X-C motif chemokine 3; C-X-C motif chemokine ligand 3; Chemokine (C X C motif) ligand 3; Chemokine (CXC motif) ligand 3; Cinc 2; CINC 2b; Cinc2; CINC2b; CXCL 3; Cxcl3; CXCL3_HUMAN; Cytokine induced neutrophil chemoattractant 2; Dcip1; Dendritic cell inflammatory protein 1; Gm1960; GRO protein gamma; GRO-gamma; GRO-gamma(1-73); GRO-gamma(5-73); GRO3; GRO3 oncogene; GROG; Growth regulated protein gamma; Growth-regulated protein gamma; Macrophage inflammatory protein 2 beta precursor ; Macrophage inflammatory protein 2-beta; Melanoma growth stimulatory activity gamma; Member 3; MGSA gamma; MIP 2b; MIP2-beta; MIP2B; SCYB3; Small inducible cytokine subfamily B |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
Expression Range | 35-107aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 11.9kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes. |
Subcellular Location | Secreted. |
Protein Families | Intercrine alpha (chemokine CxC) family |
Database References | HGNC: 4604 OMIM: 139111 KEGG: hsa:2921 STRING: 9606.ENSP00000296026 UniGene: PMID: 29524043 |