Recombinant Human C-X-C Motif Chemokine 14 (CXCL14), Active

Name: Recombinant Human C-X-C Motif Chemokine 14 (CXCL14), Active
Brand: Beta LifeScience
SKU: BLC-05544P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Chemokines and receptors – essential regulators of immune response, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-X-C Motif Chemokine 14 (CXCL14), Active is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to induce calcium flux of prostaglandin E2 treated THP1 human acute monocytic leukemia cells is typically 1-10 ng/mL.
Uniprotkb	O95715
Target Symbol	CXCL14
Synonyms	1110031L23Rik; 1200006I23Rik; AI414372; BMAC; bolekine; BRAK; Breast and kidney; C-X-C motif chemokine 14; C-X-C motif chemokine ligand 14; Chaemokine; CXC motif; ligand 14; Chemokine (C-X-C motif) ligand 14; Chemokine BRAK; CXC chemokine in breast and kidney ; CXCL14; CXL14_HUMAN; JSC; Kec; Kidney-expressed chemokine CXC; KS1; MGC10687; MGC124510; MGC90667; MIP 2 gamma; MIP-2G; MIP2G; MIP2gamma; NJAC; PRO273; PSEC0212; Scyb14; Small Inducible Cytokine B14; Small inducible cytokine subfamily B (Cys-X-Cys) member 14 (BRAK); Small Inducible Cytokine subfamily B; member 14; Small-inducible cytokine B14; Tumor suppressing chemokine; UNQ240
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	Tag-Free
Complete Sequence	SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Expression Range	35-111aa
Protein Length	Full Length of Mature Protein
Mol. Weight	9.4 kDa
Research Area	Immunology
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 1 M NaCl, pH 8.5
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
Subcellular Location	Secreted.
Protein Families	Intercrine alpha (chemokine CxC) family
Database References	HGNC: 10640 OMIM: 604186 KEGG: hsa:9547 STRING: 9606.ENSP00000337065 UniGene: PMID: 28382159 High CXCL14 expression is associated with metastatic progression of Ovarian Cancer. PMID: 28087599 These results suggest that CXCL14 downregulation by human papillomaviruses plays an important role in suppression of antitumor immune responses. PMID: 27143385 Platelets are a relevant source of CXCL14. Platelet-derived CXCL14 at the site of vascular lesions might play an important role in vascular repair/regeneration. PMID: 28359053 Epithelial CXCL14 expression is significantly associated with ERalpha positivity and low proliferation, whereas stromal CXCL14 expression is not linked to any of the established clinicopathological parameters, subtypes of breast cancer or tumour stroma abundance. PMID: 27115465 Elevated expression of CXCL14 in osteosarcoma tissues correlated with poor prognosis of the osteosarcoma patients. PMID: 27259322 Elevated S100A6 enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma. PMID: 25760073 three of these five genes (CXCL14, ITGAX, and LPCAT2) harbored polymorphisms associated with aggressive disease development in a human GWAS cohort consisting of 1,172 prostate cancer patients. PMID: 25411967 Prometastatic effects of IRX1 were mediated by upregulation of CXCL14/NF-kappaB signaling. PMID: 25822025 CXCL14 overexpression influences proliferation and changes in cell cycle distributions of HT29 colorectal carcinoma cells. PMID: 24938992 Data indicate that site-specific CpG methylation in the CXC chemokine CXCL14 promoter is associated with altered expression. PMID: 25102097 CXCL14 displays antimicrobial activity against E. coli and S. aureus. PMID: 12949249 Genetic or pharmacologic inhibition of NOS1 reduced the growth of CXCL14-expressing fibroblasts. PMID: 24710408 CXCL14 inhibits colorectal cancer migration, invasion, and epithelial-to-mesenchymal transition (EMT) by suppressing NF-kappaB signaling. PMID: 24099668 Downregulation of CXCL14 expression is associated with gastric adenocarcinoma. PMID: 23982764 CXCL14 plays a pivotal role as a potential tumor suppressor in hepatocellular carcinoma. PMID: 24033560 Smoking-induced CXCL14 expression in the human airway epithelium links chronic obstructive pulmonary disease to lung cancer. PMID: 23597004 CXCL14 binding to glycoproteins harboring heparan sulfate proteoglycans and sialic acids leads proliferation and migration of some cancer cells. PMID: 23161284 CXCL14 might be a potential novel prognostic factor to predict the disease recurrence and overall survival and could be a potential target of postoperative adjuvant therapy in CRC patients PMID: 23294544 CXCL14 is a negative regulator of growth and metastasis in breast cancer. PMID: 22910931 These results indicated that upregulation of BRAK was accompanied by differentiation of epithelial cells induced by calcium/calmodulin signaling, and that SP1 binding to the BRAK promoter region played an important role in this signaling. PMID: 22382027 The rs2237062 polymorphism in the CXCL14 gene might influence Hepatits B Virus-related hepatocellular carcinoma progression in a Chinese population. PMID: 21556757 CEACAM-1 and CXCL-14 are involved in the occurrence and development of infantile hemangioma. PMID: 20737948 The results indicate that oxidative stress induced by H(2)O(2) or HO(*) stimulates angiogenesis and tumuor progression by altering the gene expression of CXCL14 via the EGFR/MEK/ERK pathway in human HNSCC cells. PMID: 20815772 Data indicate that the expression of BRAK stimulated the formation of elongated focal adhesions of the HSC-3 cells in an autocrine or paracrine fashion, in which stimulation may be responsible for the reduced migration of the cells. PMID: 20067447 CXCL14 methylation in sputum from asymptomatic early-stage lung cancer cases was associated with a 2.9-fold elevated risk for this disease compared with controls, substantiating its potential as a biomarker for early detection of lung cancer PMID: 20562917 Taken together, the data indicate that the respective stress-dependent action of p38 isoforms is responsible for the up-regulation of the gene expression of the chemokine BRAK/CXCL14. PMID: 20478268 CXCL14 removal from conditioned media abolished its chemotactic properties. Findings offer direct evidence for epigenetic regulation of chemokine expression in tumor cells. PMID: 20460540 Increased severity of collagen-induced arthritis in CXCL14-transgenic mice is associated with enhanced T helper (Th) type 1 cytokine production, elevated autoantibody levels and increased inflammatory cell infiltration into the joints. PMID: 20212097 Data conclude that CXCL14 is likely to be regulated by progesterone in human endometrium and that it may exert a chemoattractive effect on uNK cells and in part be responsible for their clustering around the epithelial glands. PMID: 19903701 Results suggest that CXCL14 plays an important role in regulating trophoblast invasion through an autocrine/paracrine manner during early pregnancy. PMID: 19833716 loss of BRAK expression from tumors may facilitate neovascularization and possibly contributes to immunologic escape PMID: 15548693 The finding that CXCL14 expression inhibits prostate tumor growth suggests this gene has tumor suppressive functions. PMID: 15651028 CXCL14 is a potent chemoattractant and activator of dendritic cells (DC) and may be involved in DC homing in vivo. PMID: 15843547 results indicate that BRAK/CXCL14 is a chemokine, having suppressive activity toward tumor progression of oral carcinoma in vivo PMID: 16884687 This study elucidates a post-translational mechanism for the loss of CXCL14 in cancer and a novel mode of chemokine regulation. PMID: 16987528 CXCL14 might play a pivotal role in the pathobiology of pancreatic cancer, probably by regulating cancer invasion. PMID: 18054154 CXCL14 is a gene target of RhoBTB2 and supports downregulation of CXCL14 as a functional outcome of RhoBTB2 loss in cancer. PMID: 18762809 CXCL14-positive epithelial cells were found in all tissue types. The expression of CXCL14 was not associated with any tumor or patient characteristics analyzed PMID: 18765527 Data suggest that despite the structural homology and similarity in tissue distribution of human and murine CXCL14, distinct differences point to diverse, species-specific needs for CXCL14 in epithelial immunity. PMID: 18809336 Cell supernatant-derived CXCL14 fights bacteria at the earliest stage of infection, well before the establishment of inflammation, and thus fulfills a unique role in antimicrobial immunity. PMID: 19109182 regulates energy metabolism and eating behaviior, induces insulin resistance, suppresses induction of neovascularization. (review) PMID: 19172796 identify CXCL14 as a novel autocrine stimulator of fibroblast growth and migration, with multi-modal tumor-stimulatory activities PMID: 19218429 CXCL14 expression is upregulated by ROS through the AP-1 signaling pathway and promotes cell motility through elevation of cytosolic Ca(2+) by binding to the inositol 1,4,5-trisphosphate receptor on the endoplasmic reticulum in breast cancer. PMID: 19276362 -A-induced migration depends on the selective and polarized release of 2 chemokines, namely CXC chemokine ligands 12 and 14 PMID: 19339694

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.