Recombinant Human C-X-C Motif Chemokine 13 Protein (CXCL13) Protein (His)

Name: Recombinant Human C-X-C Motif Chemokine 13 Protein (CXCL13) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08408P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Chemokines and receptors – essential regulators of immune response, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-X-C Motif Chemokine 13 Protein (CXCL13) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O43927
Target Symbol	CXCL13
Synonyms	ANGIE; ANGIE2 ; B cell attracting chemokine 1; B cell-attracting chemokine 1; B lymphocyte chemoattractant; B-cell chemoattractant ; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); BCA-1; BLC; BLR1L ; C-X-C motif chemokine 13; Chemokine (C-X-C motif) ligand 13 ; Chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant) ; Chemokine; CXC motif; ligand 13; CXC chemokine BLC; CXCL13; CXL13_HUMAN; SCYB13; Small inducible cytokine B subfamily (Cys-X-Cys motif); member 13 (B-cell chemoattractant); Small inducible cytokine B13; Small inducible cytokine subfamily B; member 13; Small-inducible cytokine B13
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS
Expression Range	23-95aa
Protein Length	Partial
Mol. Weight	12.8kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
Subcellular Location	Secreted.
Protein Families	Intercrine alpha (chemokine CxC) family
Database References	HGNC: 10639 OMIM: 605149 KEGG: hsa:10563 STRING: 9606.ENSP00000286758 UniGene: PMID: 30083887 We found a strong association of CXCL13 rs355689*C allele with essential hypertension under additive (OR 0.56, PFDR = 0.008) and dominant (OR 0.41, PFDR 4.38 x 10- 4) genetic model. Our results indicate that CXCL13 rs355689 polymorphism is strongly associated with essential hypertension in the ethnic group of Tatars from Russia. PMID: 30019153 High CXCL13 expression was associated with larger tumor diameter and shorter OS. By multivariate analysis, CXCL13 expression was associated with OS independently from clinicopathological factors. PMID: 29085997 IL-17 enhances the migration of B cells during asthma by inducing CXCL13 chemokine production in structural lung cells. PMID: 27639935 the findings of the present study indicated that the noninvasive investigation of urinary CXCL13/Cr may be valuable for the detection of AR, particularly antibodymediated rejection . In addition, high urinary CXCL13/Cr levels predicted a poor response to steroid treatment and compromised graft function PMID: 29956754 CXCL13 seems to be a useful marker of disease activity in systemic lupus erythematosus, but not in cutaneous lupus erythematosus or chronic cutaneous lupus erythematosus. PMID: 29728857 Serum level of CXCL13 is associated with disease activity in systemic lupus erythematosus but does not seem to be a biomarker for arthritis. PMID: 29338586 Serum CXCL13 positivity was found to be associated with oral symptoms, ocular signs and hyperglobulinemia in Asian Indian patients with primary Sjogren's syndrome. PMID: 29541901 we found that CXCL13 indeed has a high sensitivity and specificity for diagnosing LNB, which means that it can be used as a new diagnostic biomarker for the diagnosis of LNB. PMID: 28972436 the elevated concentrations of CXCL13, CXCL8, and CXCL10 or their increasing CSF/serum ratios may be potential biomarkers of neurosyphilis PMID: 27650493 CXCL13 is a highly sensitive and specific CSF marker that helps to differentiate Lyme neuroborreliosis from other central nervous system disorders in children. PMID: 28859668 Study suggested that maternal rs355687 variant in CXCL13 gene was associated with decreased risk of HBV intrauterine infection compared to those with CC genotypes. PMID: 27212637 Elevations in serum MDC and BLC were independently associated with the significant risk of early stage lung adenocarcinoma, even in non-smokers and in stage IA patients. PMID: 27811371 Studied CSF levels of B-lymphocyte Chemoattractant CXCL13 in children with Lyme neuroborreliosis (LNB), and found CSF CXCL13 levels were substantially higher in children with LNB compared with children with other diagnoses. PMID: 28661964 This study indicated that CXCL13 may be pathogenically involved in Clostridium difficile infection (CDI) and served as a potential new biomarker for diagnosis and prognosis in CDI. PMID: 27685937 This study indicated that CXCL13 rather than IL-31 may have clinical values of diagnosis and prognosis in hepatocellular carcinoma. PMID: 27663978 CXCL13/CXCR5 mediated the aggregation of B cells, that directed the aberrant humoral immune responses via the formation of ectopic germinal centers, which suggests a molecular mechanism of neurological damage in neurosyphilis. PMID: 28931218 High CXCL13 expression is associated with B-cell Lymphoma. PMID: 28108506 CCL21 and CXCL13 levels are increased in the minor salivary glands of patients with Sjogren's syndrome. PMID: 27782867 we demonstrate that PKCepsilon cooperates with the loss of the tumor suppressor Pten for the development of prostate cancer in a mouse model. Mechanistic analysis revealed that PKCe overexpression and Pten loss individually and synergistically upregulate the production of the chemokine CXCL13, which involves the transcriptional activation of the CXCL13 gene PMID: 28402859 During remission, serum CXCL13 and BAFF levels have not decreased to normal in neuromyelitis optica patients, and B-cell-related autoimmune response persists. Immunosuppressive therapy decreased serum BAFF levels, but did not affect CXCL13 expression. PMID: 28413701 This study suggested that increased serum levels of CXCL13 might be involved in renal ectopic lymphoid tissue (ELT)formation and renal impairment process in lupus nephritis. PMID: 27990444 CXCL13 mRNA expression and protein levels were significantly up-regulated in the brain from temporal lobe epilepsy patients. PMID: 27873133 CXCL13 could be a potential biomarker for predicting recurrence in HBV-related hepatocellular carcinoma patients after hepatectomy. PMID: 26517519 was overexpressed in pulmonary vascular lesions of patients with IPAH and CTEPH, and increased serum concentrations were found in patients with IPAH and CTEPH, suggesting a potential pathogenic role of CXCL13 in both diseases. PMID: 26927848 Findings suggest the potential use of chemokine CXCL13 as a plasma biomarker of germinal centers (GCs) activity in vaccine trials and other clinical settings. PMID: 26908875 Aqueous humor concentration of CXCL13 is correlated with subfoveal choroidal thickness in normal subjects. PMID: 26121407 Serum CXCL10 and CXCL13 levels may serve as clinical markers and contribute to the inflammatory response, especially skin manifestations thereof, in adult-onset Still's disease PMID: 26385705 findings reveal a neuronal/astrocytic interaction in the spinal cord by which neuronally produced CXCL13 activates astrocytes via CXCR5 to facilitate neuropathic pain. PMID: 26752644 Gene encoding CXCL13 was identified as being upregulated and found to be negatively correlated with survival over 3-year follow-up period in Idiopathic pulmonary fibrosis. PMID: 26109466 Therefore, CSF CXCL13 concentrations could improve the diagnosis of ANS in HIV-infected patients PMID: 25769888 In the presence of endometriosis, proliferative-phase endometrial expression of CXCL13 markedly increased. PMID: 25031316 CXCL13 and CCL4 could act as circulating biomarkers in autoimmune hemolytic anemia (AIHA), and higher plasma soluble TNFRII might favor the diagnosis of SLE-related instead of primary AIHA. PMID: 25889297 This is the first to indicate the clinical relevance of CXCL13 to young breast cancer and represents a potential therapeutic target for young breast cancer. PMID: 25990390 Findings demonstrate a link between CXCL13 and primary Sjogren's syndrome disease activity and lymphoma. PMID: 26359802 CXCL13 plays an important role in the progression of hepatocellular carcinoma. PMID: 26161394 a direct target of IRF5 resulting in the enhanced recruitment of B and T cells to IRF5-positive tumor-conditioned media PMID: 25533286 CXCL13 might predict survival outcomes in patients with extranodal natural killer (NK)/T-cell lymphoma PMID: 25966773 our findings suggest that CXCL13-CXCR5 axis promotes the growth, migration, and invasion of colon cancer cells, probably via PI3K/AKT pathway PMID: 25476740 CXCL13 up-regulation may be differently linked to the development of primary central nervous system lymphomas and to the accumulation of tumor-infiltrated lymphocytes. PMID: 25433721 marked elevations of serum CXCL13 levels resided nearly completely within the seropositive population of rheumatoid arthritis patients PMID: 24766912 In primary biliary cirrhosis, CXCL13 promotes aggregation of CD19(+) B cells and CXCR5(+) CD4(+) T cells. PMID: 25627620 CSF CXCL13 levels correlated with CSF cell count, total protein, IgG Index and with the presence of CSF IgG and IgM oligoclonal bands. PMID: 26004159 Data indicate that patients with high baseline plasma C-X-C motif chemokine 13 (CXCL13) levels had an improved chance of remission after 2 years. PMID: 25249397 After validation in larger patient groups, CXCR5 and CXCL13 may prove useful as biomarkers for nonsmall cell lung carcinoma Correspondingly, blockade of this axis could serve as an effective therapy for nonsmall cell lung carcinoma. PMID: 25271023 Data show that chemokine CXCL13 production by monocytes required toll-like receptor 7 activation and secretion of interferon-alpha. PMID: 25667414 Myofibroblast activation and CXCL13 expression also occur in the normal prostate after androgen deprivation, and CXCL13 is expressed by myofibroblasts in human prostate cancer. PMID: 25267627 The study confirms the relevance of CXCL13 as a diagnostic biomarker of neuroborreliosis and suggests that CSF CXCL13 in NB is linked to duration of disease PMID: 19965843 overexpressed in myasthenia gravis thymus PMID: 24393484 highly significant stepwise progressive increase in CXCL 13 level was recorded through controls, inactive SLE and active disease (P < 0.01). Moreover, it correlated positively with SLEDAI and proteinuria (P < 0.01). PMID: 25812350

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.