Recombinant Human C-X-C Motif Chemokine 13 Protein (CXCL13) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08408P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human C-X-C Motif Chemokine 13 Protein (CXCL13) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08408P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human C-X-C Motif Chemokine 13 Protein (CXCL13) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O43927 |
| Target Symbol | CXCL13 |
| Synonyms | ANGIE; ANGIE2 ; B cell attracting chemokine 1; B cell-attracting chemokine 1; B lymphocyte chemoattractant; B-cell chemoattractant ; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); BCA-1; BLC; BLR1L ; C-X-C motif chemokine 13; Chemokine (C-X-C motif) ligand 13 ; Chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant) ; Chemokine; CXC motif; ligand 13; CXC chemokine BLC; CXCL13; CXL13_HUMAN; SCYB13; Small inducible cytokine B subfamily (Cys-X-Cys motif); member 13 (B-cell chemoattractant); Small inducible cytokine B13; Small inducible cytokine subfamily B; member 13; Small-inducible cytokine B13 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS |
| Expression Range | 23-95aa |
| Protein Length | Partial |
| Mol. Weight | 12.8kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5. |
| Subcellular Location | Secreted. |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Database References | HGNC: 10639 OMIM: 605149 KEGG: hsa:10563 STRING: 9606.ENSP00000286758 UniGene: PMID: 30083887 |
