Recombinant Human C-X-C Chemokine Receptor Type 4 (CXCR4) Protein (His-SUMO&Myc)

Name: Recombinant Human C-X-C Chemokine Receptor Type 4 (CXCR4) Protein (His-SUMO&Myc)
Brand: Beta LifeScience
SKU: BLC-02292P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Car-nk targets proteins, Chemokines and receptors – essential regulators of immune response, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-X-C Chemokine Receptor Type 4 (CXCR4) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P61073
Target Symbol	CXCR4
Synonyms	CXCR4; C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; FB22; Fusin; HM89; LCR1; Leukocyte-derived seven transmembrane domain receptor; LESTR; Lipopolysaccharide-associated protein 3; LAP-3; LPS-associated protein 3; NPYRL; Stromal cell-derived factor 1 receptor; SDF-1 receptor; CD antigen CD184
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-SUMO&C-Myc
Target Protein Sequence	PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS
Expression Range	303-352aa
Protein Length	Partial of Isoform 2
Mol. Weight	25.2kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Involved in the AKT signaling cascade. Plays a role in regulation of cell migration, e.g. during wound healing. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival.; (Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) for human immunodeficiency virus-1/HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Cell junction. Early endosome. Late endosome. Lysosome. Note=In unstimulated cells, diffuse pattern on plasma membrane. On agonist stimulation, colocalizes with ITCH at the plasma membrane where it becomes ubiquitinated. In the presence of antigen, distributes to the immunological synapse forming at the T-cell-APC contact area, where it localizes at the peripheral and distal supramolecular activation cluster (SMAC).
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 2561 OMIM: 162643 KEGG: hsa:7852 STRING: 9606.ENSP00000386884 UniGene: PMID: 30251699 Together, these data suggest that the S18-2 protein induces epithelial to mesenchymal cell transition through the TWIST2/E-cadherin signalling and, consequently, CXCR4-mediated migration of prostate cancer cells. PMID: 29396484 Study identified a variant near the chemokine receptor CXCR4 that was jointly associated with increased risk for progressive supranuclear palsy and Parkinson's disease. In addition, a mouse model of tauopathy, expression of CXCR4 and functionally associated genes was significantly altered in regions of the mouse brain that accumulate neurofibrillary tangles most robustly. PMID: 29636460 The expression of CXCR4 and mTOR were found to be negatively correlated with remission. Kaplan-Meier analysis indicated a significant decrease in the rate of progression-free survival (PFS) and in that of overall survival (OS) in patients positive for CXCR4 and mTOR expression. PMID: 28952842 the CXCL12-CXCR4 axis promotes the migration, invasion, and EMT processes in B-CPAP cells, at least partly, by activating the NF-kappaB signaling pathway. PMID: 29316404 results demonstrate that non-oxidizable HMGB1 induce a sustained cardiac fibroblasts migration despite the redox state of the environment and by altering CXCL12/CXCR4 axis. This affects proper cardiac remodeling after an infarction. PMID: 28716707 CXCR4 is highly abundant in the zona glomerulosa and in aldosterone producing adenomas suggesting a significant role in adrenocortical physiology and further representing a potential target for molecular imaging of aldosterone-producing tissue. PMID: 29279316 High CXCR4 expression is associated with bladder cancer progression. PMID: 30015971 The overexpression of CXCR4 increased sVCAM1, and the sVCAM1 secreted from CXCR4-overexpressing non-small cell lung carcinoma cells recruited and arrested additional osteoclast progenitors to promote osteoclastogenesis. PMID: 30355915 MiR-125b functions as an important downstream mediator upon the activation of CXCL12/CXCR4 axis. PMID: 28176874 Data suggest that CXCL12 and its receptor CXCR4 are critical in maintaining homeostasis, specifically during hematopoiesis. Present clinical trials (especially in hematological tumors) are testing whether adding CXCR4 inhibitors to impair tumor dissemination will increase effectiveness of ongoing anti-cancer treatments. (CXCL12 = C-X-C motif chemokine ligand 12; CXCR4 = C-X-C motif chemokine receptor-4) [REVIEW] PMID: 29288743 hypoxiainduced expression of CXCR4 promoted trophoblast cell migration and invasion via the activation of HIF1alpha, which is crucial during placentation. PMID: 29786753 CXCR4 expression was up-regulated in NSCLC cell lines. Inhibition of CXCR4 may reduce EMT, invasion and migration of NSCLC cells. PMID: 29972256 results suggest that BCP-ALL cells create a leukemic niche that attracts leukemic cells in a CXCR4/CXCL12-independent manner PMID: 28619846 Serum CXCR4 and CXCL12 levels increase significantly in septic neonates and they are valuable marker in diagnosis of neonatal sepsis. Serum concentrations of both chemokines represent promising novel biomarkers for neonatal sepsis. PMID: 28562124 study provides atomistic-level description of the activation dynamics of the C-X-C chemokine receptor type 4 (CXCR4), a class A GPCR and important drug target PMID: 30238101 CXCL12 and CXCR4 polymorphisms may be risk factors for hepatocellular carcinoma (HCC), and they may be potential HCC markers. PMID: 29741398 The results suggested that CXCR4 is a predictor of poor prognosis and may serve as a biomarker of the mesenchymal subtype in patients with Glioblastoma multiforme (GBM). In addition, CXCR4 mediated the mitogenactivated protein kinase signaling pathway, which was identified specifically in patients with mesenchymal GBM. PMID: 29767255 Stromal cell derived factor-1/C-X-C chemokine receptor type 4 axis induces human dental pulp stem cell migration through FAK/PI3K/Akt and GSK3beta/beta-catenin pathways. PMID: 28067275 EGFR Over-expression and Mutations Leading to Biological Characteristics Changes of Human Lung Adenocarcinoma Cells through CXCR4/CXCL12 Signaling Pathway PMID: 30037369 BACH1 may inhibit the progression of colorectal cancer through BACH1/CXCR4 pathway. PMID: 29481800 High CXCR4 expression is associated with differential expression patterns in adenocarcinoma and squamous cell carcinoma of the lung relative to small cell lung cancer. PMID: 30076481 No significant associations were found between mean plasma levels of either CXCL12 or CXCR4 with age, gender, tumor site, tumor size, lymph-node involvement or tumor stage PMID: 29693336 The aim of the present study was to assess whether fibrosis markers, estrogen receptor (ER)alpha and the stromal derived factor (SDF)1/CXC chemokine receptor type 4 (CXCR4) axis are abnormally expressed in Intrauterine adhesions endometrium. PMID: 29568895 Daily oral administration of AMD070 significantly inhibited the lung metastasis of B88SDF1 cells in nude mice. These results indicated that AMD070 could be useful as a novel orally bioavailable inhibitor of oral cancer metastasis PMID: 29749473 These data demonstrated that JWA suppressed the migration/invasion of breast carcinoma cells by downregulating the expression of CXCR4, and suggested that JWA may harbor prognostic and therapeutic potential in patients with breast cancer. PMID: 29658570 These results suggest that SDF1 (e.g. presented on proteoglycans) can rapidly activate integrins in an allosteric manner by binding to site 2 in the absence of CXCR4. The allosteric integrin activation by SDF1 is a novel target for drug discovery PMID: 29301984 High CXCR4 expression is associated with lymph node metastasis in colorectal cancer. PMID: 29719205 This effect can be suppressed by miR-613 through directly downregulating CXCR4. PMID: 29845707 These results suggest a key role for the CXCR4-CXCL12 chemokine axis in breast cancer progression and highlight the prognostic importance of this chemokine axis for breast cancer survival. PMID: 29516917 CXCR4 can induce PI3Kdelta inhibitor resistance in ABC DLBCL. PMID: 29472546 Our results demonstrated greater expression of pRET and CXCR4 in cisplatinresistant neuroblastomas (NBs). Vandetanib significantly inhibited SHSY5YR cell proliferation, colony formation, and invasion, while downregulating pRET and CXCR4 expression PMID: 29436676 disruption of the CXCR4/CXCL12 axis by CXCR4 antagonist AMD3100 blocked the contribution of both cancer and stromal cells to the metastatic cascade in the liver. PMID: 29436696 LncRNA PRNCR1 up-regulates CXCR4 through targeting miR-211-5p, which affects osteogenic differentiation and thus contributing to osteolysis after hip replacement PMID: 29775758 Results demonstrated that miR-1246 inhibited cell invasion and EMT process by targeting CXCR4 and blocking JAK/STAT and PI3K/AKT signal pathways in lung cancer cells. PMID: 29171984 High CXCR4 expression is associated with hepatocellular and cholangiocellular carcinomas in tumor capillaries. PMID: 29282035 Each of the CXCR4-derived peptides exhibited high affinity for GroEL with a binding stoichiometry near seven. It is found that the peptides interact with the paired alpha helices in the apical domain of the chaperonin. Each of the two chaperonin rings is competent for accommodating all the seven CXCR4 peptides bound to GroEL under saturation conditions. ATP alone or combined with GroES promoted the peptide release from... PMID: 29627450 Down-regulation of CXCR4 significantly reduced the cell proliferation, while remarkably increased the cell apoptosis and apoptotic protein expression levels in osteosarcoma cells. PMID: 29734183 Quercetin suppressed breast cancer stem cell proliferation, self-renewal, and invasiveness. It also lowered the expression levels of proteins related to tumorigenesis and cancer progression, such as aldehyde dehydrogenase 1A1, C-X-C chemokine receptor type 4, mucin 1, and epithelial cell adhesion molecules. PMID: 29353288 Icaritin enhances MSC proliferation, chemotaxis to stromal cell-derived factor-1 and osteogenic differentiation through STAT-3 activation, with a consequential up-regulation in the expression and activity of CXCR4. Phosphorylated STAT-3 binds the CXCr4 promoter upregulating its expression. PMID: 29679717 CXCL11 did not significantly alter the (13)C-(1)H-HSQC spectrum of CXCR4. Our findings point towards ubiquitin as a biased agonist of CXCR4 PMID: 28455789 High CXCR4 expression may define a specific subtype of sporadic malignant peripheral nerve sheath tumor with favorable prognosis. PMID: 29020982 Data support the importance of SDF-1 and CXCR4 expression for loco-regional control and overall survival in HNSCC after primary radiochemotherapy. PMID: 29061496 Presence of SST5, CXCR4 and ETA on tumor cells and of SST3, CXCR4 and ETA on microvessels gradually increased from grade II to grade IV tumors. PMID: 29696364 These data revealed that CXCR4 is a novel hepatocellular carcinoma (HCC)vascular marker for vessel sprouting and could serve as a potential therapeutic target and a predictive factor for sorafenib treatment in patients with HCC PMID: 28223275 Hetero-oligomerization of a1B/D-adrenergic receptor with the chemokine (C-X-C motif) receptor 4:atypical chemokine receptor 3 heteromeric complex is required for a1B/Dadrenergic receptor function. PMID: 28862946 CXCR4+ cells were increased in response to DOXO, mainly in human cardiac mesenchymal progenitor cells (CmPC), a subpopulation with regenerative potential. PMID: 28837147 This work demonstrates distinct roles for the SDF-1/CXCR4 or CXCR7 network in human induced pluripotent stem cell-derived ventricular cardiomyocyte specification, maturation and function. PMID: 28711757 implantation of IGF1R(+) human dental pulp mesenchymal stem cells exerted enhanced neuroplasticity via integrating inputs from both CXCR4 and IGF1R signaling pathways. PMID: 27586516 CXCR4 was overexpressed on systemic lupus erythematosus B cells, positively correlating with disease activity and kidney involvement PMID: 27665947

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.