Recombinant Human C-X-C Chemokine Receptor Type 3 (CXCR3) Protein (His-GST)

Name: Recombinant Human C-X-C Chemokine Receptor Type 3 (CXCR3) Protein (His-GST)
Brand: Beta LifeScience
SKU: BLC-05159P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-X-C Chemokine Receptor Type 3 (CXCR3) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P49682
Target Symbol	CXCR3
Synonyms	CXCR3; GPR9; C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; CKR-L2; G protein-coupled receptor 9; Interferon-inducible protein 10 receptor; IP-10 receptor; CD antigen CD183
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-GST
Target Protein Sequence	EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN
Expression Range	4-50aa
Protein Length	Partial
Mol. Weight	36.6 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells (HMC) through a heterotrimeric G-protein signaling pathway. Binds to CCL21. Probably promotes cell chemotaxis response.; Receptor for the C-X-C chemokine CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the proliferation, survival and angiogenic activity of human microvascular endothelial cells (HMVEC) through a cAMP-mediated signaling pathway. Does not promote cell chemotaxis respons. Interaction with CXCL4 or CXCL10 leads to activation of the p38MAPK pathway and contributes to inhibition of angiogenesis. Overexpression in renal cancer cells down-regulates expression of the anti-apoptotic protein HMOX1 and promotes apoptosis.; Mediates the activity of CXCL11.
Subcellular Location	[Isoform 1]: Cell membrane; Multi-pass membrane protein.; [Isoform 2]: Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 4540 OMIM: 300574 KEGG: hsa:2833 STRING: 9606.ENSP00000362795 UniGene: PMID: 29286143 Up-regulated CXCR3 is detectable in the amniotic fluid and associated with the presence of placental lesions consistent with maternal anti-fetal rejection so may serve as a potential marker of spontaneous preterm delivery. PMID: 28829757 the expression of chemokine receptors in different peripheral blood T-cell subsets in patients with polymyositis (PM) and dermatomyositis, was examined. PMID: 28869080 Results suggest that infiltration of chemokine (C-X-C motif) receptor 3 (CXCR3)-positive plasma cells is a characteristic feature of Hunner type interstitial cystitis (HIC). PMID: 27339056 Results of this study indicate that CXCR3 overexpression in GC is associated with increased DC and TIL infiltration and improved OS. PMID: 29266971 Following activation with T-cell receptor and co-culture with various concentrations of chrysotile fibers using freshly isolated CD4+ surface CXCR3 positive and negative fractions, the intracellular expression of CXCR3, IFNgamma and IL-17 remained unchanged when co-cultured with chrysotile. PMID: 28498408 In conclusion, it seems that decreased expression of CXCR3 and higher expression of CCR6 were associated with HTLV-1 infection, what indicate that these alterations may favor virus dissemination but not disease manifestation. PMID: 28206670 Alternatively spliced variant of CXCR3 mediates the metastasis of liver cancer. PMID: 26883105 The CXCL4 monomer acts as the minimal active unit for interacting with CXCR3 N-Terminal Sulfated Peptide, and sulfation of N-terminal tyrosine residues on the receptor is important for binding. PMID: 28945356 approach has been able to describe the structural events which dynamically characterize the molecular mechanisms involved in the binding of CXCR3 to CXCL11 and the critical role exerted by its N-terminal region in "hunting" and capturing the ligand. PMID: 29054054 High CXCR3 expression is associated with chronic lymphocytic leukaemia in comparison to small lymphocytic lymphoma. PMID: 29153094 CD4(+)CXCR3(+) T cells are highly enriched in the inflamed mucosa of intestinal bowel disease patients. PMID: 26732675 Up-regulation of CXCR3 chemokine and its ligands in bronchoalveolar lavage fluid during organizing pneumonia increases the risk of chronic lung allograft dysfunction after lung transplantation. PMID: 28686641 These data suggest that elevated IP-10 levels may impair NK cell function during HIV infection and that IP-10/CXCR3 blocking may be a novel therapeutic strategy in the control and functional cure of HIV. PMID: 28465448 Our result showed that CXCR2 expression was correlated with high grade (P = 0.024), advanced stage (P = 0.029) and metastasis (P = 0.018). The log-rank test revealed that high CXCR2 and CXCR3 expressions are related to poorer overall survival (P < 0.001; P < 0.001). PMID: 27273823 The percentage of CXCR3(+) CD4(+) TEM cells negatively correlated with the severity of the cutaneous disease in psoriasis patients. Importantly CLA(+) CD4(+) TCM cells expressing CCR6(+) or CCR4(+)CXCR3(+) negatively correlated with psoriasis severity suggesting recruitment to the skin compartment. PMID: 28392462 Our studies suggest that CXCR3 is a key contributor to the pathogenesis of Alopecia areata by mediating the infiltration of autoreactive CD8+NKG2D+ T cells into the skin PMID: 27412416 TNF-alpha augments CXCR2 and CXCR3 to promote the progression of renal cell carcinoma leading to a poor prognosis. PMID: 27297979 TNF-alpha upregulated the expression of CXCR3 in HUVECs PMID: 27565063 TLR9 ligands may contribute to the immunopathogenesis of sarcoidosis via induction of CXCL10 release in the alveolar macrophages. PMID: 27390897 The CXCL10/CXCR3 axis mediates T-cell recruitment into the skin in progressive vitiligo. Blocking this chemotactic mechanism may present a new form of therapy. PMID: 26801009 these data suggest that CXCR3A contributes to the growth, invasion and metastasis of gastric cancer cells in vitro and in vivo, and thus may be a key mediator of gastric cancer progression. PMID: 27461521 IP-10 complexes with CXCR3, which in turn activates the ERK1/2 pathway, thus resulting in upregulation of p-CREB and increased vascular smooth muscle cell proliferation. PMID: 28111710 the CXCR3+/CCR5+ expression was higher in the neoplastic as compared to the hyperplastic nodules. PMID: 27872865 monocytes and lymphocytes cooperate to enhance migration towards CXCR3 chemokines and CCL5 in COPD PMID: 26965295 CXCL10/CXCR3 axis promotes gastric cancer cell invasion and migration by upregulating MMP-2 and MMP-9 production via PI3K/AKT pathway. PMID: 27470388 CXCR3 expression in chronic lymphocytic leukemia cells was a strong determinant of a worse clinical outcome. PMID: 26589908 Speculate that aberrant expression of CXCR3 in marginal zone lymphoma of the skin is associated with migration of lymphoma cells to the epidermis and could lead to an epidermotropic pattern. PMID: 26275313 CXCR3 role in autoimmune thyroiditis [review] PMID: 24999582 Both CXCL10 and CXCR3 appeared to be useful in differentiating T1R reaction in borderline leprosy while CXCR3 alone differentiated BT from BT-T1R PMID: 26831417 CXCR3 expression was upregulated in advanced gastric cancer and was associated with increased CD4+, CD8+ tumor-infiltrating lymphocyte infiltration and improved overall survival PMID: 26823797 CXCR3 was also linked to steatosis through inducing hepatic lipogenic genes PMID: 26394162 congruent with the concept that inflammation plays a key role in the pathogenesis of LV dysfunction, MIG, IP10 and I-TAC add diagnostic accuracy over and beyond NT-pro BNP. PMID: 26506526 Suggest that aberrant CXCR3 expression may play crucial roles in suppressing prostate carcinoma metastasis by inhibiting cell proliferation and invasion through the PCLbeta signaling pathway. PMID: 26339376 The expression of the chemokine receptors CXCR3, CXCR4 and CXCR7 and their ligands. PMID: 26037167 This study is aimed at the optimization of a new analytical method for metabolic profiling with parallel bioaffinity assessment of CXCR3 ligands of the azaquinazolinone and piperazinyl-piperidine class and their metabolites. PMID: 26164305 CXCR3-A, the predominant form in hematopoietic cells, mediates tumor "go" signaling by promoting cell proliferation, survival, chemotaxis, invasion and metastasis; while CXCR3-B, on epithelial cells, mediates "stop" signaling PMID: 25663474 Common variants of CXCR3 and its ligands CXCL10 and CXCL11 are associated with vascular permeability of dengue infection in peninsular Malaysia. PMID: 25858769 our study suggested a potential use of CXCR3 overexpression as a prognostic marker for gastric cancer PMID: 26434630 CD4+ T cells demonstrated markedly decreased CXCR3 expression. PMID: 25768944 Results indicate that CXC chemokine receptors 3 (CXCR3) contributes to spontaneous preterm birth (SPTB). PMID: 26209629 High expression of CXCR3 is associated with glioblastoma patients with an invasive phenotype. PMID: 25527046 Report crosstalk between TGF-beta1 and CXCR3 signaling in the regulation of urethral fibrosis. PMID: 24907118 Expression of CXCR3 in fibroblasts is associated with the expression of IL-13Ralpha2. PMID: 25514189 Targeting of both CXCR3 isoforms may be important to block the stem cell-promoting actions of CXCR3-B, while inhibiting the pro-proliferative and metastasis-promoting functions of CXCR3-A. PMID: 25537642 CXCR3 has been demonstrated to be strongly related to tumour progression in advanced colorectal cancer. PMID: 25232565 CXCR3 and IP-10 are involved in the pathogenesis of bronchiolitis, and CXCR3 is associated with allergic factors. PMID: 25760840 Higher percentages of CCR4+ CD4 TEM cells in acute RSV infection were accompanied with higher percentages of CXCR3+ CD8 TEM cells, whereas the development of long-lived memory CXCR3+ CD4 and CD8 TCM cells seems to be compromised PMID: 25013801 the participation of the chemokine CXCL10/CXCR3 axis in celiac disease pathogenesis PMID: 24586509 The different groups of clinically stable nonallergic asthmatic patients showed distinct patterns of alterations in subset distribution as well as CCR6, CXCR3, and CCR5 expression on circulating T lymphocytes. PMID: 25178112

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.