Recombinant Human C-Type Lectin Domain Family 4 Member D (CLEC4D) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04271P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human C-Type Lectin Domain Family 4 Member D (CLEC4D) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04271P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human C-Type Lectin Domain Family 4 Member D (CLEC4D) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q8WXI8
Target Symbol CLEC4D
Synonyms C type (calcium dependent; carbohydrate recognition domain) lectin; superfamily member 8; C type lectin domain family 4; member D; C type lectin like receptor 6; C type lectin receptor; C type lectin superfamily member 8; C-type lectin domain family 4 member D; C-type lectin superfamily member 8; C-type lectin-like receptor 6; CLC4D_HUMAN; CLEC 6; CLEC-6; Clec4d; CLEC6; CLECSF8; lectin; C type; superfamily member 8; Macrophage C type lectin; MCL; MGC40078; MPCL
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
Expression Range 39-215aa
Protein Length Extracellular Domain
Mol. Weight 36.7kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system: recognizes damage-associated molecular patterns (DAMPs) of pathogen-associated molecular patterns (PAMPs) of bacteria and fungi. The PAMPs include alpha-mannans on C.albicans hypheas and mycobacterial trehalose 6,6'-dimycolate (TDM). Interacts with signaling adapter Fc receptor gamma chain/FCER1G, likely via CLEC4E, to form a functional complex in myeloid cells. Binding of mycobacterial TDM or C.albicans alpha-mannans to this receptor complex leads to phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes. The heterodimer formed with CLEC6A is active against fungal infection. Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T-cells.
Subcellular Location Cell membrane; Single-pass type II membrane protein.
Database References

HGNC: 14554

OMIM: 609964

KEGG: hsa:338339

STRING: 9606.ENSP00000299665

UniGene: PMID: 24101491

  • CLECSF8 functions as an activation receptor on myeloid cells and associates with a novel adaptor molecule PMID: 22689578
  • Cross-linking of the receptor leads to a rapid internalization suggesting that CLECSF8 constitutes and endocytic receptor. PMID: 14971047

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Sale
    SDS-PAGE analysis of Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein, CAT# BLT-08014P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein
    • Molecule: CEBPB;
    • Species: Mouse;
    • Expression system: E.coli;
    • Tag: N-His-GST;
    • Sequence: 1-296aa;
    CAT#: BLT-08014P

    Save $50
    Sale
    SDS-PAGE analysis of Human BAX (Apoptosis Regulator Bax) - Recombinant Protein, CAT# BLT-07419P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human BAX (Apoptosis Regulator Bax) - Recombinant Protein
    • Molecule: BAX;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-171aa;
    CAT#: BLT-07419P

    Save $50
    Recently viewed