Recombinant Human C-Type Lectin Domain Family 4 Member C (CLEC4C) Protein (His-SUMO), Active

Name: Recombinant Human C-Type Lectin Domain Family 4 Member C (CLEC4C) Protein (His-SUMO), Active
Brand: Beta LifeScience
SKU: BLC-05637P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human CLEC4C antibody, the EC 50 of human CLEC4C antibody is 31.43-43.52 μg/ml.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CLEC4C.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-Type Lectin Domain Family 4 Member C (CLEC4C) Protein (His-SUMO), Active is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Activity	Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human CLEC4C antibody, the EC50 of human CLEC4C antibody is 31.43-43.52 μg/ml.
Uniprotkb	Q8WTT0
Target Symbol	CLEC4C
Synonyms	CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL; UNQ9361/PRO34150C-type lectin domain family 4 member C; Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD antigen CD303
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Expression Range	45-213aa
Protein Length	Extracellular Domain
Mol. Weight	36.0 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells. Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. Binds to serum IgG. Efficiently targets ligand into antigen-processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium.
Subcellular Location	Cell membrane; Single-pass type II membrane protein.
Database References	HGNC: 13258 OMIM: 606677 KEGG: hsa:170482 STRING: 9606.ENSP00000353500 UniGene: PMID: 29796630 decrease in the surface expression of CLEC4C and the endoplasmic reticulum localization of the mutant construct were observed PMID: 26943047 Human BDCA2+CD123+CD56+ dendritic cells (DCs) related to blastic plasmacytoid dendritic cell neoplasm represent a unique myeloid DC subset. PMID: 25779340 BDCA-2 binds selectively to glycans containing the epitope Galbeta1-3/4GlcNAcbeta1-2Man. PMID: 25995448 We show the crystal structures of a carbohydrate recognition domain (CRD) of human C-type lectin receptor blood dendritic cell antigen-2 (BDCA2). PMID: 24425442 Reduction in Treg numbers following Ag delivery to BDCA2 restored both CD4(+) T cell activation and Ab responses, demonstrating that Tregs were required for the observed tolerance. PMID: 24829416 Data show that HCV envelope glycoprotein E2 is a novel ligand of blood dendritic cells antigen 2 (BDCA-2). PMID: 23053572 Human C-type lectin domain family 4, member C (CLEC4C/BDCA-2/CD303) is a receptor for asialo-galactosyl-oligosaccharides. PMID: 21880719 Accumulation of BDCA-1 and BDCA-2 around neovessels showed that mDCs and pDCs are recruited to advanced arteriosclerotic plaques. PMID: 21436634 Expression of dendritic cell markers CD11c/BDCA-1 and CD123/BDCA-2 in coronary artery disease upon activation in whole blood. PMID: 20888334 Indoleamine 2,3-deoxigenase positive plasmacytoid dentritic cells are the classical BDCA2 positive cells in melanoma lymph nodes PMID: 19829303 Data suggest that by associating with Fc epsilon RI gamma, BDCA2 activates a novel BCR-like signaling pathway to regulate the immune functions of plasmacytoid dendritic cells. PMID: 17850179 Triggering CD303 leads to tyrosine phosphorylation of Syk, Slp65, PLCgamma2 and cytoskeletal proteins. CD303 signaling is linked with internalization by clathrin-mediated endocytosis. PMID: 18022864 results suggest that downregulation of BDCA2 expression on plasmacytoid dendritic cells (pDCs) may reflect the activation of pDCs accumulated in systemic lupus erythematosus patients & may be one marker for indication of disease activity of SLE patients PMID: 18684674 Engagement of BDCA-2 blocks TRAIL-mediated cytotoxic activity of plasmacytoid dendritic cells. PMID: 19577819

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.