Recombinant Human C Reactive Protein / CRP (denatured)
Beta LifeScience
SKU/CAT #: BLA-12470P
Recombinant Human C Reactive Protein / CRP (denatured)
Beta LifeScience
SKU/CAT #: BLA-12470P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P02741 |
Synonym | Pentraxin 1, short C reactive protein C reactive protein pentraxin related C-reactive protein(1-205) CRP CRP_HUMAN MGC88244 Pentraxin 1 PTX 1 PTX1 |
Description | Recombinant Human C Reactive Protein / CRP (denatured) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGY SIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTS WESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGS QSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVF TKPQLWP |
Molecular Weight | 23 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |