Recombinant Human C-C Motif Chemokine 8 (CCL8) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10919P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human C-C Motif Chemokine 8 (CCL8) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10919P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human C-C Motif Chemokine 8 (CCL8) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P80075 |
| Target Symbol | CCL8 |
| Synonyms | Ccl8; CCL8_HUMAN; HC14; MCP-2; MCP-2(6-76); Monocyte chemoattractant protein 2; Monocyte chemotactic protein 2; SCYA10; SCYA8; Small-inducible cytokine A8 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
| Expression Range | 24-99aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 35.9kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8. |
| Subcellular Location | Secreted. |
| Protein Families | Intercrine beta (chemokine CC) family |
| Database References | HGNC: 10635 OMIM: 602283 KEGG: hsa:6355 STRING: 9606.ENSP00000378118 UniGene: PMID: 29148603 |
