Recombinant Human C-C Motif Chemokine 5 (CCL5) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03596P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human C-C Motif Chemokine 5 (CCL5) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03596P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human C-C Motif Chemokine 5 (CCL5) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P13501 |
| Target Symbol | CCL5 |
| Synonyms | Beta chemokine RANTES; Beta chemokine RANTES precursor; C C motif chemokine 5; CCL 5; CCL5; CCL5_HUMAN; Chemokine (C C motif) ligand 5; Chemokine CC Motif Ligand 5; D17S136E; EoCP; Eosinophil chemotactic cytokine; MGC17164; RANTES(4-68); Regulated upon activation normally T expressed and presumably secreted; SCYA 5; SCYA5; SIS delta; SIS-delta; SISd; Small inducible cytokine A5 (RANTES); Small inducible cytokine A5; Small inducible cytokine subfamily A (Cys Cys) member 5; Small-inducible cytokine A5; T cell specific protein p288; T cell specific protein RANTES; T cell specific RANTES protein; T cell-specific protein P228; T-cell-specific protein RANTES; TCP 228; TCP228 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| Expression Range | 24-91aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 11.9kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells. |
| Subcellular Location | Secreted. |
| Protein Families | Intercrine beta (chemokine CC) family |
| Database References | HGNC: 10632 OMIM: 187011 KEGG: hsa:6352 STRING: 9606.ENSP00000293272 UniGene: PMID: 29382912 |
