Recombinant Human C-C Motif Chemokine 3 (CCL3) Protein (His)
Recombinant Human C-C Motif Chemokine 3 (CCL3) Protein (His)
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Chemokines and receptors – essential regulators of immune response, Christmas & new year research sale — 30% off storewide, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human C-C Motif Chemokine 3 (CCL3) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Activity | Not tested. |
| Uniprotkb | P10147 |
| Target Symbol | CCL3 |
| Synonyms | (G0/G1 switch regulatory protein 19-1)(Macrophage inflammatory protein 1-alpha)(MIP-1-alpha)(PAT 464.1)(SIS-beta)(Small-inducible cytokine A3)(Tonsillar lymphocyte LD78 alpha protein)(4-69)(LD78-alpha(4-69) |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | C-6His |
| Target Protein Sequence | SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Expression Range | 24-92aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 14.6 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). |
| Subcellular Location | Secreted. |
| Protein Families | Intercrine beta (chemokine CC) family |
| Database References | HGNC: 10627 OMIM: 182283 KEGG: hsa:6348 STRING: 9606.ENSP00000225245 UniGene: PMID: 30419802 |
