Recombinant Human C-C Motif Chemokine 3 (CCL3), Active
Beta LifeScience
SKU/CAT #: BLC-05438P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human C-C Motif Chemokine 3 (CCL3), Active
Beta LifeScience
SKU/CAT #: BLC-05438P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human C-C Motif Chemokine 3 (CCL3), Active is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by the ability of Recombinant CCL3 to chemoattract human CCR5 transfected BaF3 mouse proB cells is typically 3-10 ng/mL. |
| Uniprotkb | P10147 |
| Target Symbol | CCL3 |
| Synonyms | C C motif chemokine 3; CCL 3; CCL3; CCL3_HUMAN; Chemokine (C C motif) ligand 3; Chemokine C C motif ligand 3; Chemokine ligand 3; G0/G1 switch regulatory protein 19 1; G0/G1 switch regulatory protein 19-1; G0S19 1; G0S19 1 protein; Heparin binding chemotaxis protein; L2G25B ; LD78 alpha; LD78-alpha(4-69); LD78alpha; Macrophage inflammatory protein 1 alpha ; Macrophage inflammatory protein 1-alpha; macrophage inflammatory protein 1a; MIP 1 alpha; MIP 1A; MIP-1-alpha; MIP-1-alpha(4-69); MIP1 alpha; MIP1A; PAT 464.1; SCYA 3; SCYA3; SIS alpha; SIS beta; SIS-beta; Small inducible cytokine A3 ; small inducible cytokine A3 (homologous to mouse Mip-1a); Small-inducible cytokine A3; Tonsillar lymphocyte LD78 alpha protein |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Complete Sequence | SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Expression Range | 24-92aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 7.5 kDa |
| Research Area | Immunology |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). |
| Subcellular Location | Secreted. |
| Protein Families | Intercrine beta (chemokine CC) family |
| Database References | HGNC: 10627 OMIM: 182283 KEGG: hsa:6348 STRING: 9606.ENSP00000225245 UniGene: PMID: 30419802 |
