Recombinant Human C-C Motif Chemokine 25 (CCL25) Protein (GST)

Name: Recombinant Human C-C Motif Chemokine 25 (CCL25) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-10042P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Chemokines and receptors – essential regulators of immune response, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-C Motif Chemokine 25 (CCL25) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O15444
Target Symbol	CCL25
Synonyms	A130072A22Rik; C-C motif chemokine 25; CCL 25; CCL25; CCL25_HUMAN; Chemokine (C C motif) ligand 25; Chemokine (CC motif) ligand 25; Chemokine C C motif ligand 25; Chemokine CC motif ligand 25; Chemokine TECK; Ck beta 15; Ckb 15; Ckb15; MGC125074; MGC150327; SCY A25; SCYA 25; SCYA25; Small inducible cytokine A25; Small inducible cytokine A25 isoform 1 precursor; Small inducible cytokine A25 isoform 2 precursor; Small inducible cytokine subfamily A (Cys Cys) member 25; Small inducible cytokine subfamily A Cys Cys member 25; Small inducible cytokine subfamily A; member 25; Small-inducible cytokine A25; TECK; TECKvar; Thymus expressed chemokine; Thymus-expressed chemokine
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Expression Range	24-150aa
Protein Length	Full Length of Mature Protein
Mol. Weight	41.2kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Subcellular Location	Secreted.
Protein Families	Intercrine beta (chemokine CC) family
Database References	HGNC: 10624 OMIM: 602565 KEGG: hsa:6370 STRING: 9606.ENSP00000375086 UniGene: PMID: 30060561 It plays a pathogenic role in liver diseases and it will be a therapeutic target of the diseases. PMID: 27795503 TECK was shown to be expressed by osteoblasts, and its receptor, CCR9, by osteoclast precursors. TECK increased P. gingivalis LPS-induced osteoclast numbers in an in vitro osteoclast formation assay using osteoclast precursors. T PMID: 26921718 that CCL25/CCR9 signal may provide cancer cells with chemotactic abilities through influencing several epithelial-mesenchymal transitionmarkers PMID: 27008282 CCR9/CCL25 interactions are not only involved in colitis pathogenesis but also correlate with colonic inflammatory burden; further supporting the existence of overlapping mucosal lymphocyte recruitment pathways between the inflamed colon and liver. PMID: 26873648 CpG methylation is reduced in gingival biopsies of patients with periodontitis PMID: 26472015 Studies indicate important roles played by chemokine ligand 25 (CCL25)/chemokine receptor 9 (CCR9) in tumorigenesis, tumor chemoresistance and metastasis. PMID: 26879872 CCL25 mRNA and protein levels were significantly increased in the nasopharyngeal carcinoma group compared with the control group. PMID: 26279399 CCR9-CCL25 interaction promoted proliferation and suppressed apoptosis of non-small cell lung cancer cells by activating the PI3K/Akt pathway. PMID: 25691296 High CCL25 expression is associated with the pathogenesis of ulcerative colitis. PMID: 24936795 Expression of CCR9 and CCL25, the only natural ligand of CCR9, was significantly higher (p<0.0001) in NSCLC tissues and serum respectively, compared to their respective controls. PMID: 25296976 TECK derived from endometrial stromal cell and macrophages upregulates the number and function of Tregs in the ectopic milieu. PMID: 25275597 CCL25 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus. PMID: 12949249 CCL25 and CCR9 regulate colorectal cancer progression and invasion. PMID: 22863617 cell migration assays revealed that mesenchymal stromal cells (MSCs) have tropism toward multiple myeloma (MM) cells, and CCL25 was identified as a major MM cell-produced chemoattractant for MSCs. PMID: 22102554 We provide the first evidence that CCR9 and its natural ligand CCL25 are highly expressed by ovarian cancer tissue and their expression correlates with histological subtypes. PMID: 21637913 CCL25 enhanced the expression of MMP-1, -9, -11 and -13 active proteins by BrCa cells in a CCR9-dependent fashion. PMID: 21344163 CCL25 may be involved in the differentiation of monocytes to macrophages particularly in rheumatoid arthritis PMID: 20738854 over-expressed TECK interacts with CCR9 on the endometrial stromal cells in the endometriotic milieu, which may contribute to the onset and progression of endometriosis. PMID: 20081876 demonstrate a unique pattern of regulation for CCL25 and suggest a role for caudal type homeo box proteins in regulating CCL25 transcription PMID: 16517733 Intracellular signaling required for CCL25-stimulated T cell adhesion mediated by the integrin alpha4beta1. PMID: 17510295 High expression may explain high incidence of melanoma metastis to the small intestine. PMID: 18245522 There was a robust migration of specific IgA- and IgM-antibody-secreting cells induced by Salmonella vaccination toward the mucosal chemokines CCL25 and CCL28 PMID: 19003934

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.