Recombinant Human C-C Motif Chemokine 22 (CCL22) Protein (GST)

Name: Recombinant Human C-C Motif Chemokine 22 (CCL22) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08418P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Chemokines and receptors – essential regulators of immune response, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-C Motif Chemokine 22 (CCL22) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O00626
Target Symbol	CCL22
Synonyms	A 152E5.1; ABCD 1; ABCD1; C C motif chemokine 22; CC chemokine STCP 1; CC chemokine STCP-1; ccl 22; Ccl22; CCL22_HUMAN; Chemokine (C C motif) ligand 22; DC/B CK; DCBCK; Macrophage-derived chemokine; MDC; MDC(1-69); MDC(7-69); MGC34554; SCYA22; Small inducible cytokine subfamily A (Cys Cys) member 22; Small inducible cytokine subfamily A; member 22; Small-inducible cytokine A22; STCP 1; STCP1; Stimulated T cell chemotactic protein 1 ; Stimulated T-cell chemotactic protein 1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVP
Expression Range	25-82aa
Protein Length	Partial
Mol. Weight	33.7kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chemotactic for monocytes, dendritic cells and natural killer cells. Mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemoattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC(3-69), MDC(5-69) and MDC(7-69) seem not be active.
Subcellular Location	Secreted.
Protein Families	Intercrine beta (chemokine CC) family
Database References	HGNC: 10621 OMIM: 602957 KEGG: hsa:6367 STRING: 9606.ENSP00000219235 UniGene: PMID: 28898872 blood CCL22 levels were positively associated with IgE sensitization at age 2. A high cord blood CCL22/CXCL10 chemokine ratio was significantly associated with a higher risk of allergic sensitization at age 3. PMID: 27863395 Tumor-associated macrophages promote prostate cancer migration through activation of the CCL22-CCR4 signaling axis. PMID: 28039457 Elevations in serum MDC and BLC were independently associated with the significant risk of early stage lung adenocarcinoma, even in non-smokers and in stage IA patients. PMID: 27811371 CCL22 plays an important role in supporting gastric cancer development presumably by increasing the percentage of regulatory T cells in the tumor microenvironments. CCL22 levels in sera have a predictive value for gastric cancer peritoneal metastasis and the early recurrence. PMID: 28501127 The CCL22-mediated enhancement of antitumor responses is however not due to conversion, but rather to redirection of existing regulatory T cells to the site of cutaneous overexpression. PMID: 27634754 CCL22 and IL-37 with a co-localization in non-small cell lung cancer A549 cells inhibited the proliferation and epithelial-mesenchymal transition process PMID: 27499437 Our results demonstrate that CCL22 is expressed in human placenta. Decidual expression was only observed in miscarriage conditions and correlates with Treg infiltration. PMID: 25922986 Distinctive Treg associated CCR4-CCL22 expression profile with altered frequency of Th17/Treg cell in the immunopathogenesis of Pemphigus Vulgaris. PMID: 26093920 type I IFN blocks the regulatory T cell-attracting chemokine CCL22 and thus helps limit the recruitment of regulatory T cells to tumors PMID: 26432403 First-episode psychosis patients had higher serum CCL22, which decreased substantially following antipsychotic treatment. PMID: 25970596 Elevated levels of CCL22 found in the ascites could create a chemokine gradient aiding in Treg cells migration. Increased Tregs percentage in the local microenvironment of ovarian cancer might be an important mechanism of immunosuppression. PMID: 25647263 Circulating CCL22 levels are related to both glioma risk and survival duration independent of age, histology, grade and IDH mutation status. CCL22 should be considered a marker of immune status with potential prognostic value PMID: 25604093 CCL22 is a novel mediator of lung inflammation following hemorrhage and resuscitation PMID: 25136780 CCR4 C1014T and CCL22 C16A genetic variations were neither associated with the risk, nor with the progression of colorectal cancer in Iranian population PMID: 25148803 The serum CCL22 levels were affected by genetic variations at SNP rs223818. Accordingly, SNP rs223818 may play a role in the susceptibility to breast cancer. PMID: 25722218 Sesamin suppressed lipopolysaccharide induced CCL22 expression in monocytes through the ER/PPAR-a, the MAPK-p38 pathway, the NFkB-p65 pathway and the epigenetic regulation by suppressing histone H3/H4 acetylation in the CCL22 promoter region. PMID: 25117529 CCL22 could be an immune marker in ANCA-associated vasculitis. PMID: 25352172 Suggest that lower CCL22 levels may play an important role in the pathogenesis of multiple sclerosis in women. PMID: 24254331 CCL22 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus. PMID: 12949249 genetic polymorphism is not associated with breast carcinoma in Southern Iranian population PMID: 23268288 both CCL22 and TGF-beta1 are candidate chemoattractants for intratumoral Foxp3 (+)Tregs infiltration; however, unlike the later, CCL22 is an independent prognostic predictor of BC patients. PMID: 24124553 Autistic children had significantly higher serum levels of MDC than healthy controls PMID: 23782855 Data suggest that decreased levels of plasmatic CCL22 may contribute to CD4(+) lymphopaenia. PMID: 23265706 lymph node metastasis of CCR4(+) HNSCC is promoted by CCL22 in an autocrine or M2-like macrophage-dependent paracrine manner. PMID: 23180648 High cord blood levels of the Th2 related chemokine CCL22 were significantly associated with high total- IgE levels during the first 6 years of life, but not with specific sensitization, asthma, eczema or allergic rhinitis. PMID: 23106659 findings suggest that HBV infection and activity of the TGF-beta-miR-34a-CCL22 axis serve as potent etiological factors to predispose hepatocellular carcinoma patients for the development of portal vein tumor thrombus PMID: 22975373 results suggested that suppression of the CCL22 gene using Salmonella induced anti-inflammatory effects PMID: 21823987 Data suggest that variants of C-C motif chemokine 22 (CCL22) play a role in susceptibility to atopic dermatitis (AD) in a gain-of-function manner. PMID: 22125604 chemokine CCL22 may have a role in abdominal aortic aneurysm PMID: 20348247 CCL22 may be responsible for the infiltration of CD4(+)CD25(high) T cells into the pleural space of patients with tuberculous pleurisy. PMID: 20337996 Plasma concentration of CCL22 correlates with the frequency of circulating CD4-positive FoxP3-positive (CD4+FoxP3+) regulatory T cells (Tregs) in human T-lymphotropic virus (HTLV) type 1-infected subjects. PMID: 20525891 Endocrine disrupting chemicals suppressed CCL22 and IP-10 levels in cultured monocytes via, at least in part, the MKK1/2-ERK MAPK pathway and histone H4 acetylation. PMID: 19756997 Data show that MDC/CCL22 is present in the synovial membrane of rheumatoid arthritis (RA) and psoriatic arthritis (PsA) patients and in synovial fluid of patients with RA and PsA, which would enable migration of CCR4 expressing memory cells. PMID: 19942450 Chronic lymphocytic leukemia B cells are endowed with the capacity to attract CD4+, CD40L+ T cells by producing CCL22, suggesting a vicious circle, leading to the progressive accumulation of the neoplastic cells. PMID: 11981828 Neither MDC release nor MDC mRNA was detected in any of the 3 types of fibroblasts stimulated with any of the cytokines examined. PMID: 12642832 Serum levels of TARC and MDC in atopic dermatitis patients were significantly higher than those found in normal controls. PMID: 15113590 CCL22 induced accumulation of phosphatidylinositol-(3,4,5)-trisphosphate in the leukemic T cell line CEM. CCL22 also had the ability to chemoattract human Th2 cells and CEM cells in a pertussis toxin-sensitive manner. PMID: 15187160 CCL17 and CCL22, which are constitutively produced by immature DCs, mediate both T cell polarization and attraction. PMID: 15210758 Elevated bronchial mucosal expression of MDC/CCL22 is implicated in asthma pathogenesis; its action is partly through selective development and retention, or recruitment of T helper type 2, not Th1, receptor-bearing cells. PMID: 15944327 MDC/CCL22 has a role in inhibiting progression of lung cancer PMID: 16453150 These data suggest that the CCL22 level produced by monocyte derived dendritic cells thus reflects the disease activity of Atopic dermatitis (AD) and it may also play an important role regarding the production of CCL22 in the pathogenesis of AD. PMID: 17008059 A trend towards a decreased allelic frequency of the A allele of the CCL22 C/A SNP as well as of the T allele of the CCL17 C/T SNP was found in MS patients compared with controls. PMID: 17967467 HTLV-1-infected T cells produce CCL22 through Tax and selectively interact with CCR4+CD4+ T cells, resulting in preferential transmission of HTLV-1 to CCR4+CD4+ T cells. PMID: 18178833 MDC/CCL22 is likely to play a role in the development of multiple sclerosis in females only, possibly influencing the intracerebral recruitment of Th2 cells, which produce anti-inflammatory cytokines PMID: 18208895 Significantly higher CCL22 expression is associated with gastric cancer PMID: 18224687 although IE86 does repress the UL144-mediated activation of a synthetic NFkB promoter, it is unable to block UL144-mediated activation of the CCL22 promoter, and this lack of responsiveness to IE86 appears to be regulated by binding of CREB. PMID: 18287226 serum CCR4 ligands (CCL17 and CCL22)may be useful inflammatory markers for assessing atopic dermatitis severity in children PMID: 18435706 Development of allergic disease is associated with a more marked Th2-like deviation already at birth, shown as increased levels of cord blood IgE and MDC (CCL22) and higher ratios of MDC (CCL22) to IP-10 (CXCL10) and I-TAC (CXCL11). PMID: 19175890 Regulatory T cells recruited through CCL22/CCR4 are selectively activated in lymphoid infiltrates surrounding primary breast tumors and lead to an adverse clinical outcome. PMID: 19244125

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.