Recombinant Human C-C Motif Chemokine 19 (CCL19) Protein (GST)

Name: Recombinant Human C-C Motif Chemokine 19 (CCL19) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-10039P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Chemokines and receptors – essential regulators of immune response, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-C Motif Chemokine 19 (CCL19) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q99731
Target Symbol	CCL19
Synonyms	Beta chemokine exodus 3; Beta-chemokine exodus-3; C C chemokine ligand 19; C-C motif chemokine 19; CC chemokine ligand 19; CCL 19; CCL19; CCL19_HUMAN; Chemokine (C C motif) ligand 19; Chemokine (CC motif) ligand 19; Chemokine C C Motif Ligand 19; Chemokine CC Motif Ligand 19; CK beta 11; CK beta-11; CKb 11; CKb11; EBI 1 ligand chemokine; EBI1 ligand chemokine; ELC; Epstein-Barr virus-induced molecule 1 ligand chemokine; Exodus 3; Exodus3; Macrophage inflammatory protein 3 beta; MGC34433; MIP 3 beta; MIP 3B; MIP-3-beta; MIP-3b; MIP3 beta; MIP3B; OTTHUMP00000000531; SCYA 19; SCYA19; Small inducible cytokine A19; Small inducible cytokine subfamily A (Cys Cys) member 1; Small-inducible cytokine A19
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Expression Range	22-98aa
Protein Length	Full Length of Mature Protein
Mol. Weight	35.8kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Subcellular Location	Secreted.
Protein Families	Intercrine beta (chemokine CC) family
Database References	HGNC: 10617 OMIM: 602227 KEGG: hsa:6363 STRING: 9606.ENSP00000308815 UniGene: PMID: 28856757 The research findings demonstrate for the first time that the chemokines CCL19, CCL21 and CCR7 play important roles in bone destruction by increasing osteoclast migration and resorption activity, and that has been linked to rheumatoid arthritis pathogenesis. PMID: 28729639 breast cancers-derived soluble factors increase the migration of DCs toward CCL19. PMID: 27451948 The migratory index to the CCR7 ligands, CCL19 and CCL21, was higher in T-cells from donors whose recipients will develop GvHD. PMID: 28112745 Study confirmes that CCL19 induces the invasion and migration of breast cancer cells through the expression of markers of epithelial-mesenchymal transition. PMID: 28378417 findings connect NOTCH1, DUSP22, and CCL19-driven chemotaxis within a single functional network, suggesting that modulation of the homing process may provide a relevant contribution to the unfavorable prognosis associated with NOTCH1 mutations in CLL. PMID: 28017968 Deletion of this extended C-terminus reduces CCL21's affinity for heparin and transferring the CCL21 C-terminus to CCL19 enhances heparin binding mainly through non-specific, electrostatic interactions PMID: 27338641 CCL19 is significantly overexpressed in patients with unstable carotid atherosclerotic plaques and may be a possible novel biomarker for identifying high-risk patients in whom more urgent intervention may be indicated. PMID: 27498092 CrkL regulates CCL19 and CCR7-induced epithelial-to-mesenchymal transition via ERK signaling pathway in epithelial ovarian carcinoma patients. PMID: 25636509 The solution structure of CCL19 is reported. It contains a canonical chemokine domain. Chemical shift mapping shows the N-termini of PSGL-1 and CCR7 have overlapping binding sites for CCL19 and binding is competitive. PMID: 26115234 Our findings serve to elucidate the molecular mechanisms underlying the resistin induction of CCL19 expression in ECs and the shear-stress protection against this induction. PMID: 25656506 The mRNA levels of CCL19/CCL21 in ankylosing spondylitis hip ligament were significantly higher than in osteoarthritis ligament. PMID: 25260647 Serum CCL19 and CCL21 were up-regulated during Rickettsia conorii infection. PMID: 24507453 CCL19 promoted monocyte adhesion to HUVEC cells. CCL19 rs2227302 was associated with coronary artery disease in a Chinese Han population. PMID: 24990231 CCL19 is an antimicrobial protein with bacteriocidal activity against E. coli. PMID: 12949249 CCL19 (rather than CCL21) may contribute to the accumulation of dendritic cells and macrophages in the inflamed lungs of patients with eosinophilic pneumonia. PMID: 24111618 CIP4 is expressed at abnormally high levels in CLL cells, where it is required for CCL19-induced chemotaxis. PMID: 23644527 Serum CCL19 measurement is a new hallmark of the B cell-mediated rheumatoid arthritis subtype and may predict clinical response to rituximab. PMID: 23740460 A high expression of CCL19 was a good prognostic factor of lung adenocarcinoma. PMID: 23922113 Our findings would suggest that CCL19 and CCL21 may not be associated with cervical lymph node metastasis or other clinical and microscopic factors in oral squamous cell carcinoma. PMID: 22976543 a novel signaling pathway that controls EDG-1 up-regulation following stimulation of T cells by CCR7 and CCL19. PMID: 22334704 involvement of CCL19 in AIDS patients with advanced immunodeficiency, potentially mediating both adaptive and maladaptive responses PMID: 22288592 These results suggest a new combinatorial guiding mechanism by CCL19 and CCL21 for the migration and trafficking of CCR7 expressing leukocytes. PMID: 21464944 increased expression of MIP-3alpha favors recruitment of immature DCs to the tumour bed, whereas de novo local expression of SLC and MIP-3beta induces accumulation of mature DCs at the tumour margin forming clusters with T-cells PMID: 20969772 Klebsiella pneumoniae-triggered DC recruit human NK cells in a CCR5-dependent manner leading to increased CCL19-responsiveness and activation of NK cells. PMID: 20865789 Nuclear localization of four and a half LIM domains 2 (FHL2) transgene is lost in mature but not immature bone marrow-derived dendritic cells following stimulation with CCL19. PMID: 20592280 The CCL19 is known to be critically involved in lymphocyte and dendritic cell trafficking, CCL19-binding competition by CRAM might be involved in modulating these processes. PMID: 20002784 CC chemokine CCL19 attracts mature T cells out of the fetal thymus organ culture. PMID: 11869682 Desensitizing concentrations of CCL21 and CCL19 had no significant effects on T lymphocyte transendothelial migration. PMID: 11870628 located in high endothelial venules in an appropriate location to induce transendothelial migration of CLL cells into lymph nodes PMID: 11929789 Characterization of mouse CCX-CKR, a receptor for the lymphocyte-attracting chemokines TECK/mCCL25, SLC/mCCL21 and MIP-3beta/mCCL19: comparison to human CCX-CKR. (CCX-CKR) PMID: 11981810 migration to CCL19 and CCL21 is dependent on phospholipase C and intracellular calcium flux but not on phosphatidylinositol-3 kinase PMID: 14592837 CCL19 and CXCL12 have roles in chemotaxis of mantle cell lymphoma B cells PMID: 14871974 MIP-3beta was expressed in the human endometrium, but our results could not strongly support the hypothesis that MIP-3beta is a potential chemoattractant for endometrial NK cells. PMID: 15019823 The ccl19 migrated poorly towards the GFP UCB or normal (NL) BM CD34+ cells, p210 UCB and CML CD34+ cells. PMID: 15674360 By conditioning naive T cells into a motile dendritic cell-scanning state, CCL19 promotes antigen-independent responses and increases the probability of cognate histocompatibility complex (MHC)-peptide encounter. PMID: 16081805 Nitric oxide (NO) donor NOR4 provides a signal allowing LPS-stimulated DCs to migrate toward CCL19. PMID: 16249377 The maturation, in vitro migration and cytokine production of human DC after stimulation with live H. pylori is reported. PMID: 16500130 The CCL19,CCL21/CCR7 chemokine system is expressed in inflamed muscles of polymyositis and may be involved in the pathomechanism of polymyositis. PMID: 16887149 Despite sharing only 25% sequence identity with CCL21, the amino terminal hexapeptide of CCL19 is capable of performing an in vitro role similar to that of CCL21, resulting in G protein activation of the CCR7 receptor. PMID: 16904643 CXCL13 and CCL19 cooperatively induce significant resistance to TNF-alpha-mediated apoptosis in acute and chronic B cell leukemia CD23+CD5+ B cells, but not in the cells from cord blood. PMID: 17082584 Expression of the CCL19 gene is regulated by a combined action of several members of the NF-kappaB, IRF, and STAT family transcription factors. PMID: 17182562 The abundance of CD83+ plasmacytoid dendritic cells (DCs) in perivascular areas and the overexpression of CCL19 and CCL21 in perivascular cellular foci suggest plasmacytoid DCs are central to the muscle inflammation in juvenile dermatomyositis. PMID: 17469160 These findings suggest hitherto unknown roles of SMAD transcription factors and of CCL19 in the elicitation phase of allergic contact dermatitis. PMID: 17597826 CCL19 plus CXCL13 regulate interaction between B-ALL CD23+CD5+ B cells and CD8+ T cells by inducing activation of PEG10, in turn, resulting in IL-10 overexpression and impairment of tumor-specific cytotoxicity in syngeneic CD8+ T cells. PMID: 17709502 This study suggests that CCL19 plays a role in both the physiological immunosurveillance of the healthy CNS and the pathological maintenance of immune cells in the CNS of MS patients. PMID: 17825430 after HIV-1 infection of CCL19- or CCL21-treated CD4(+) T-cells, low-level HIV-1 production but high concentrations of integrated HIV-1 DNA, approaching that seen in mitogen-stimulated T-cell blasts, was observed PMID: 17881634 CCL19, CCL20 and CCL22 factors could play an additive role in the pathogenesis of the inflammatory process leading to bronchiolar fibro-obliteration in lung transplant patients PMID: 18047937 experiments performed to investigate the survival, adhesion, and metalloproteases secretion indicate that CXCL13 combined with CCL19 and CCL21 mainly affects the chemotaxis of Sezary syndrome cells PMID: 18757429 Complement C1q chemoattracts human dendritic cells and enhances migration of mature dendritic cells to CCL19 via activation of AKT and MAPK pathways.( PMID: 18838169

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.