Recombinant Human C-C Motif Chemokine 16 (CCL16) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09955P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human C-C Motif Chemokine 16 (CCL16) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09955P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human C-C Motif Chemokine 16 (CCL16) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O15467 |
Target Symbol | CCL16 |
Synonyms | C-C motif chemokine 16; CCL16; CCL16_HUMAN; Chemokine (C-C motif) ligand 16; Chemokine CC-4; Chemokine LEC; CKb12; HCC-4; HCC4; IL-10-inducible chemokine; IL10 inducible chemokine; IL10 inducible chemokine; ILINCK; LCC-1; LCC1; Liver CC chemokine 1 precursor; Liver expressed chemokine; Liver-expressed chemokine; LMC; Lymphocyte and monocyte chemoattractant; Monotactin 1; Monotactin-1; MTN-1; Mtn1; NCC-4; NCC4; New CC chemokine 4; SCYA16; SCYL4; Small inducible cytokine A16 precursor; Small inducible cytokine A16 precursor; Small inducible cytokine subfamily A (Cys Cys) member 16; Small-inducible cytokine A16 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
Expression Range | 24-120aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 27.2kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES. |
Subcellular Location | Secreted. |
Protein Families | Intercrine beta (chemokine CC) family |
Database References | HGNC: 10614 OMIM: 601394 KEGG: hsa:6360 STRING: 9606.ENSP00000293275 UniGene: PMID: 29768218 |