Recombinant Human C-C Motif Chemokine 14 (CCL14) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08592P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human C-C Motif Chemokine 14 (CCL14) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08592P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human C-C Motif Chemokine 14 (CCL14) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q16627 |
Target Symbol | CCL14 |
Synonyms | CC-1; CC-3; CCL14; CCL14_HUMAN; chemokine (C-C motif) ligand 14; Chemokine CC-1/CC-3; chemokine CC1; chemokine CC3; chemokine HCC1; chemokine HCC3; CKb1; HCC 1; HCC 3; HCC-1(1-74); HCC-1(9-74); HCC-1/HCC-3; HCC-3; HCC1; HEMOFILTRATE CC CHEMOKINE 1; MCIF; NCC-2; NCC2; new CC chemokine 2; SCYA14; SCYL2; small inducible cytokine subfamily A (Cys-Cys); member 14; Small-inducible cytokine A14; SY14 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
Expression Range | 20-93aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 24.7kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induces intracellular Ca(2+) changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and is inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes, eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5. |
Subcellular Location | Secreted. |
Protein Families | Intercrine beta (chemokine CC) family |
Database References | HGNC: 10612 OMIM: 601392 KEGG: hsa:6358 UniGene: PMID: 28718365 |