Recombinant Human C-C Chemokine Receptor Type 8 (CCR8) Protein (His-Myc)

Beta LifeScience SKU/CAT #: BLC-07575P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human C-C Chemokine Receptor Type 8 (CCR8) Protein (His-Myc)

Beta LifeScience SKU/CAT #: BLC-07575P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human C-C Chemokine Receptor Type 8 (CCR8) Protein (His-Myc) is produced by our Yeast expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P51685
Target Symbol CCR8
Synonyms CCR8; CKRL1; CMKBR8; CMKBRL2; C-C chemokine receptor type 8; C-C CKR-8; CC-CKR-8; CCR-8; CC chemokine receptor CHEMR1; Chemokine receptor-like 1; CKR-L1; GPR-CY6; GPRCY6; TER1; CD antigen CDw198
Species Homo sapiens (Human)
Expression System Yeast
Tag C-6His-Myc
Target Protein Sequence MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK
Expression Range 1-35aa
Protein Length Partial
Mol. Weight 7.7 kDa
Research Area G-Protein Coupled Receptor, Receptor, Transducer
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection.
Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families G-protein coupled receptor 1 family
Database References

HGNC: 1609

OMIM: 601834

KEGG: hsa:1237

STRING: 9606.ENSP00000326432

UniGene: PMID: 28533380

  • Role of Conserved Disulfide Bridges and Aromatic Residues in Extracellular Loop 2 of Chemokine Receptor CCR8 for Chemokine and Small Molecule Binding. PMID: 27226537
  • High CCR8 expression is associated with high recurrence in kidney cancer. PMID: 26716905
  • findings suggest that CCR8 expression in ALCL is more closely related to the presence of DUSP22 rearrangements than to cutaneous involvement and that the function of CCR8 may extend beyond its skin-homing properties in this disease PMID: 25390351
  • Epidermal-derived vitamin D3 metabolites and prostaglandins provide an essential cue for the localization of CCR8+ immune surveillance T cells within healthy human skin. PMID: 26002980
  • CCL1-CCR8 interaction may play a critical role in lymphocytic recruitment in IgG4-related sclerosing cholangitis and type 1 autoimmune pancreatitis, leading to duct-centred inflammation and obliterative phlebitis. PMID: 23811304
  • Identification of human CCR8 as a CCL18 receptor. PMID: 23999500
  • CCR8(+) myeloid cell subset is expanded in patients with cancer. PMID: 23363815
  • Data show that CCR8 expression by newly activated naive T cells is regulated by skin-specific factor(s) derived primarily from epidermal keratinocytes. PMID: 23043070
  • C-terminal clipping of chemokine CCL1/I-309 enhances CCR8-mediated intracellular calcium release and anti-apoptotic activity PMID: 22479563
  • The functional data from human macrophages suggest a potential cross talk between the CCR8 and the Toll-like receptor 4 (TLR4) pathways, both of which are present in chronic obstructive pulmonary disease patients. PMID: 21976223
  • There may be a role for CCR8 in the recruitment of T cells to the lung in asthmatics. PMID: 20455898
  • CCR8 mediates rescue from dexamethasone-induced apoptosis via an ERK-dependent pathway PMID: 12525579
  • found in the central nervous system and is associated with phagocytic macrophages PMID: 12547701
  • CCR8 genes and surrounding genomic regions these genes are the result of the duplication of an ancestral gene prior to the divergence of teleost fish. PMID: 12551893
  • Transfected human CCR8-dependent activation of the RAS/MAPK pathway mediates anti-apoptotic activity of I-309/ CCL1 and vMIP-I. PMID: 12645948
  • The induction of CCR8 under conditions associated with vascular smooth muscle cell proliferation and migration raises the possibility that CCR8 may play an important role in vessel wall pathology. PMID: 14576057
  • the axis CCL1-CCR8 links adaptive and innate immune functions that play a role in the initiation and amplification of atopic skin inflammation PMID: 15814739
  • CCR8 ligands are allotropic, binding to distinct sites within CCR8; the human immune system may have evolved to use CCL7 as a selective antagonist of viral chemokine activity at CCR8 but not those of the host ligand PMID: 17023422
  • CCR8 is expressed by a small and heterogeneous population of peripheral blood CD4 memory T cells enriched in T helper type 2 (Th2) effector and T regulatory (Treg) cells. PMID: 17082609
  • CCR8-expressing CD4-positive T lymphocytes are preferentially recruited from the periphery into the lungs of asthmatic individuals, driven by elevated CCL1 levels produced almost exclusively by mast cells and basophils. PMID: 17641040
  • The combination of 17beta-E(2) with the environmental pollutant TCDD is involved in the pathogenesis of endometriosis via up-regulating the chemokine CCR8-I-309. PMID: 17693327
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed