Recombinant Human C-C Chemokine Receptor Type 7 (CCR7) Protein (His&Myc)

Name: Recombinant Human C-C Chemokine Receptor Type 7 (CCR7) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-07846P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-C Chemokine Receptor Type 7 (CCR7) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P32248
Target Symbol	CCR7
Synonyms	CCR7; CMKBR7; EBI1; EVI1; C-C chemokine receptor type 7; C-C CKR-7; CC-CKR-7; CCR-7; BLR2; CDw197; Epstein-Barr virus-induced G-protein coupled receptor 1; EBV-induced G-protein coupled receptor 1; MIP-3 beta receptor; CD antigen CD197
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	KFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP
Expression Range	332-378aa
Protein Length	Partial
Mol. Weight	13.0 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for the MIP-3-beta chemokine. Probable mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 1608 OMIM: 600242 KEGG: hsa:1236 STRING: 9606.ENSP00000246657 UniGene: PMID: 30032244 High CCR7 expression is associated with urinary bladder cancer metastasis. PMID: 28534984 these data indicate CCL19/CCR7 contributes to proliferation and invasion of ESCs, which are conducive to the pathogenesis of endometriosis through activating PI3K/Akt pathway PMID: 28856757 The research findings demonstrate for the first time that the chemokines CCL19, CCL21 and CCR7 play important roles in bone destruction by increasing osteoclast migration and resorption activity, and that has been linked to rheumatoid arthritis pathogenesis. PMID: 28729639 CXCR4, CCR7, VEGF-C and VEGF-D expression might have synergistic effects on the lymph node metastasis in patients with cervical cancer. PMID: 28535405 the acute GvHD (aGvHD) patients received higher percentage of CD4+CCR7+ T-cells in donor T-cells, whereas chronic GvHD (cGvHD) patients were transplanted with higher percentages of CD8+CCR7+ T-cells. Functional experiments demonstrated that CCR7+ T-cells exhibited higher potential for activation than CCR7- T-cells did. PMID: 28112745 these results demonstrated that CCL21/CCR7 may activate EMT in lung cancer cells via the ERK1/2 signaling pathway. PMID: 28487957 CCL21/CCR7 interaction was shown to allow NK cell adhesion to endothelial cells (ECs) and its reduction by hypoxia. PMID: 28416768 Study shows that miR-1275 can positively regulate CCR7 expression in squamous cell carcinoma of head and neck (SCCHN) with different mechanisms. PMID: 29278769 Study provide evidence that CCR7 mediates EMT progress via AKT pathway, which indicates that CCR7 has a key role in breast cancer progression. PMID: 28378417 Report an increased percentage of peripheral CCR7 T cells accompanied by endothelial dysfunction in patients with ankylosing spondylitis. PMID: 28421995 The analysis of gene amplification and mRNA levels showed the expression of CCR7 in breast cancer correlated with better prognosis. PMID: 28930757 that CCR7 mediates TGF-beta1-induced MMP2/9 expression through NF-kappaB signaling PMID: 28817313 leukocyte subsets express distinct patterns of CCR7 sialylation that contribute to receptor signaling and fine-tuning chemotactic responses. PMID: 26819318 tumor microenvironment stimulation down-regulated the migration of CCR7-expressing tumor cells toward CCL21 and inhibited the formation of directional protrusions toward CCL21 in a novel 3-dimensional hydrogel system. PMID: 26936935 CCR7 expression levels in human tumors correlate with signatures of CD141(+) DC, intratumoral T cells, and better clinical outcomes. PMID: 27424807 specific role for CCL21/CCR7 in promoting EMT and metastasis in CD133+ pancreatic cancer stem-like cells PMID: 27505247 This study showed that CCR7 are overexpressed in CD4(-) CD8(-) thymocytes of myasthenia gravis patients. PMID: 26616645 High tumoral CCR7 expression correlated with potential lymphatic involvement and poor prognosis of metastatic renal cell carcinoma patients treated with tyrosine kinase inhibitors. PMID: 28114889 Results show that upregulation of CCR7 promotes cell proliferation and inflammation in A549 non-small cell lung cancer cells. However, silencing of CCR7 via siRNA treatment promotes cell apoptosis and suppresses the inflammatory response and TGF-beta1-induced EMT, which may be associated with NF-kappaB signaling. PMID: 28339080 Down-regulating CCR7 expression in MG63 cells could apparently inhibit cell proliferation, migration and invasion abilities of MG63 cells, and also induce cell apoptosis. PMID: 27916085 These results suggest that upregulation of rat CCR7 expression does not change the phenotype, differentiation, or proliferation capacity of human adipose-derived stem cells (hASCs), but does enable efficient migration of hASCs to rat secondary lymphoid organs. PMID: 28035134 CCL21/CCR7 interaction contributes to the time-dependent proliferation of PTC cells by upregulating cyclin A, cyclin B1 and cyclin-dependent kinase 1 (CDK1) expression via the extracellular signal-regulated kinase (ERK) pathway associated with iodine. PMID: 27574129 we conclude that CCR7 gene locus harbours a polymorphism that modifies risk of MI in patients with Coronary artery disease (CAD). Replication of this association could be sought in a prospective cohort of initially healthy individuals PMID: 27317472 this study shows that plasmacytoid dendritic cells from rheumatoid arthritis patients have high expression levels of CCR7 PMID: 27421624 This study suggests that NRP1 expression and LVD are independent factors that are likely to predict the risk of LN metastasis in squamous cell carcinoma (SCC)of the tongue, whereas the expression of VEGFC, VEGFR3, CCR7, and SEMA3E are nonindependent predictive factors PMID: 27666723 High CCR7 expression is associated with gastric cancer. PMID: 26984468 CCR7 pathway up-regulates Twist expression via ERK and PI3K/AKT signaling to manage the epithelial-mesenchymal transition of pancreatic ductal adenocarcinoma PMID: 26219899 Constitutively expressed Siglec-9 inhibits LPS-induced CCR7, but enhances IL-4-induced CD200R expression in human macrophages. PMID: 26923638 High CXCR4 expression in primary breast tumors (PTs) was found to be associated with luminal A type tumor, suggesting more favorable outcome. In contrast, CCR7 and FOXP3 expressions in PTs represented luminal B tumors, pointing to more aggressive tumor behavior. Maspin expression did not differ between luminal types. PMID: 28011488 Results indicated that CCR7 is overexpressed in gallbladder cancer tissues and its expression correlates with staging and lymph node metastasis. PMID: 27009073 CCL21/CCR7 induce VEGF-D up-regulation and promote lymphangiogenesis via ERK/Akt pathway in lung cancer. PMID: 26884842 The present study demonstrated that down-regulation of CCR7 reduced proliferation, cell cycle, cell migration and invasion in prostate cancer cells PMID: 26722441 Our findings suggested that MUC1 plays an important role in CCL21-CCR7-induced lymphatic metastasis and may serve as a therapeutic target in esophageal squamous cell carcinoma . PMID: 26667143 Membrane associated PGES1dependent release of PGE2 is ccompanied by elevated CCR7 expression in colon cancer cells. PMID: 26352871 Pyk2 is a key downstream signaling molecules of CCR7 in SCCHN, which promotes SCCHN tumorigenesis and progression. PMID: 26352169 the CCR7 axis mediates TGF-beta1-induced EMT via crosstalk with NF-kappaB signaling, facilitating lymph node metastasis and poorer overall survival in patients with gastric cancer PMID: 26176983 Blockade of CCR7, or treatment with a p38 MAP kinase inhibitor, reduced lymphatic dissemination of epithelial-mesenchymal transition cells. PMID: 25961925 findings indicated that circulating memory Tfh cells, especially CCR7+ICOS+ memory Tfh cells, may be associated with the relapse of MS and may serve as a new therapeutic target PMID: 26231034 The chemotactic interaction between CCR7 and its ligand, CCL21, may be a critical event during progression in pancreatic cancer PMID: 21594558 CrkL regulates CCL19 and CCR7-induced epithelial-to-mesenchymal transition via ERK signaling pathway in epithelial ovarian carcinoma patients. PMID: 25636509 Recycling accounts, to a major extent, for the high levels of surface CXCR4/CCR7 on CLL cells. Increased CCR4/CCR7 is detectable not only in circulating leukemic cells, but also in secondary lymphoid organs of CLL patients with lymphoadenopathy. PMID: 26282174 in given donor/recipient pairs, KIR2DS4 expression may contribute to potentiating natural killer cell function by increasing both the cytotoxicity and the expression of CCR7 on their surface. PMID: 25961063 Data indicate that inhibition of TGF-beta-activated protein kinase 1 (TAK1) reduces chemokine (C-C motif) receptor 7 (CCR7) expression. PMID: 25557171 CCL21/CCR7 pathway activates signallings to up-regulate Slug pathway, leading to the occurrence of epithelial-mesenchymal transition process in human chondrosarcoma PMID: 25556164 our study suggested that CCR7 promotes Snail expression to induce the epithelial-mesenchymal transition, resulting in cell cycle progression, migration, and invasion in gastric cancer PMID: 25572817 High CCR7 expression was associated with colorectal cancer metastasis. PMID: 26179425 The solution structure of CCL19 is reported. It contains a canonical chemokine domain. Chemical shift mapping shows the N-termini of PSGL-1 and CCR7 have overlapping binding sites for CCL19 and binding is competitive. PMID: 26115234 These results reveal that CCR7 and VEGF-C display a significant crosstalk and suggest a novel role of the CCL21/CCR7 chemokine axis in the promotion of breast cancer-induced lymphangiogenesis. PMID: 25744065 High expression of CCR-7 is associated with atherosclerotic arteries. PMID: 25318003

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.