Recombinant Human C-C Chemokine Receptor Type 6 (CCR6) Protein (His&Myc)

Name: Recombinant Human C-C Chemokine Receptor Type 6 (CCR6) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-01967P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-C Chemokine Receptor Type 6 (CCR6) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P51684
Target Symbol	CCR6
Synonyms	CCR6; CKRL3; CMKBR6; GPR29; STRL22; C-C chemokine receptor type 6; C-C CKR-6; CC-CKR-6; CCR-6; Chemokine receptor-like 3; CKR-L3; DRY6; G-protein coupled receptor 29; GPR-CY4; GPRCY4; LARC receptor; CD antigen CD196
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL
Expression Range	1-47aa
Protein Length	Partial
Mol. Weight	12.9 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for the C-C type chemokine CCL20. Binds to CCL20 and subsequently transduces a signal by increasing the intracellular calcium ion levels. Although CCL20 is its major ligand it can also act as a receptor for non-chemokine ligands such as beta-defensins. Binds to defensin DEFB1 leading to increase in intracellular calcium ions and cAMP levels. Its binding to DEFB1 is essential for the function of DEFB1 in regulating sperm motility and bactericidal activity. Binds to defensins DEFB4 and DEFB4A/B and mediates their chemotactic effects. The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/ memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases. CCR6-mediated signals are essential for immune responses to microbes in the intestinal mucosa and in the modulation of inflammatory responses initiated by tissue insult and trauma. CCR6 is essential for the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for the normal migration of Th17 cells in Peyers-patches and other related tissue sites of the intestine and plays a role in regulating effector T-cell balance and distribution in inflamed intestine. Plays an important role in the coordination of early thymocyte precursor migration events important for normal subsequent thymocyte precursor development, but is not required for the formation of normal thymic natural regulatory T-cells (nTregs). Required for optimal differentiation of DN2 and DN3 thymocyte precursors. Essential for B-cell localization in the subepithelial dome of Peyers-patches and for efficient B-cell isotype switching to IgA in the Peyers-patches. Essential for appropriate anatomical distribution of memory B-cells in the spleen and for the secondary recall response of memory B-cells. Positively regulates sperm motility and chemotaxis via its binding to CCL20.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Cell surface.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 1607 OMIM: 601835 KEGG: hsa:1235 STRING: 9606.ENSP00000339393 UniGene: PMID: 30098283 Identified a population of gut-derived TREG cells producing CCR6 and CXCR6 which are significantly reduced in inflammatory bowel disease. PMID: 29981781 CCR6 facilitates tumor angiogenesis via the AKT/NF-kappaB/VEGF pathway in colorectal cancer PMID: 29097259 expression increased on B cells of systemic lupus erythematosus patients PMID: 28444576 In conclusion, it seems that decreased expression of CXCR3 and higher expression of CCR6 were associated with HTLV-1 infection, what indicate that these alterations may favor virus dissemination but not disease manifestation. PMID: 28206670 Bin1-N-BAR domains assemble into scaffolds of low long-range order that form flexible membrane tubule in the sarcolemma PMID: 27016283 CCR6 defines memory B cell precursors in mouse and human germinal centers, revealing light-zone location and predominant low antigen affinity. PMID: 29262350 High expression of CCR6 is associated with cutaneous T-cell lymphoma. PMID: 26789110 CCR6(-) regulatory T cells blunt the restoration of gut Th17 cells along the CCR6-CCL20 axis in treated HIV-1-infected patients. PMID: 26883727 results provide a potential explanation for involvement of the CCL20-CCR6 system in the trafficking of IL-17-producing cells to degenerated IVD tissues PMID: 23823618 High CCR6 expression is associated with B-lymphoblastic lymphoma with inflammation. PMID: 27018255 CCR6 expression was higher in cells derived from node-positive cases and highest expression was in cells derived from metastatic cases of colon cancer. PMID: 27149649 The study suggests that a genetic interaction between DPP4 and CCR6 is involved in RA susceptibility PMID: 27587881 point mutations in CCR6 can result in either a gain or loss of receptor function PMID: 27789680 Rheumatoid arthritis-associated double nucleotide polymorphism in CCR6 regulates CCR6 via PARP-1. PMID: 27626929 This study evaluated the role of CCL20 and CCR6 in the regulation of laryngeal neoplasms; it showed that these proteins acted on proliferation and metastasis via the p38 pathway and multiple microRNAs. PMID: 27916417 CCR6 expression may be a novel biomarker for predicting clinical outcomes for gastric cancer patients. PMID: 26489425 Cell migration assays showed that TNF-alpha treatment significantly increased the rate of migrated cells in those cells in which it also increased the membrane expression of CCR6 (TPC-1 and BCPAP) as compared to basal condition PMID: 26577851 There were early increased plasma concentrations of CCL20 and CCR6 in patients with sepsis. CCL20 and CCR6 correlate with severity of illness in ICU patients. Levels of CCR6 predicted the length of patients' admission. PMID: 26771764 High CCR6 expression is associated with Inflammatory Bowel Disease. PMID: 26536229 Tregs of unexplained recurrent miscarriage patients was significantly lower than that in controls. CCL20-CCR6 could drive immune activity of CD4(+)FOXP3(+) Tregs, followed by their migration to the feto-maternal microenvironment PMID: 26345847 AEG-1 mediates CCL20/CCR6-induced EMT development via both Erk1/2 and Akt signaling pathway in cervical cancer, which indicates that CCL20/CCR6-AEG-1-EMT pathway could be suggested as a useful target to affect the progression of cervical cancer. PMID: 26156805 The involvement of cell surface nucleolin in the initiation of CCR6 signaling in human hepatocellular carcinoma.Expression of nucleolin and CCR6 correlates with overall survival in hepatocellular carcinoma patients. PMID: 25698534 Late-onset cytomegalovirus infection was preceded by an immune phenotype characterized by increased CCR6 expression on bulk CD4(+) T cells following solid organ transplant. PMID: 25690781 The data reviewed suggest the necessity of evaluation of other blood redox-balance and nitric oxide in psoriasis should with additional investigations to targeting CCR6 rs3093024 in the genetic susceptibility of psoriasis. PMID: 25879557 the current data demonstrate a genetic association between CCR6 variants and susceptibility to lupus nephritis PMID: 26138531 Th17 cells are recruited into tumor tissues preferentially through CCR6-CCL20 pathway PMID: 25768730 High CCR6 expression is associated with colon cancer. PMID: 24866282 Leukocytes expressing CCR6 are present in the ovary immediately prior to ovulation. PMID: 26125463 The data of this study suggested that CCR6 expression, which shows an increase in both moderatesevere and mild Alaheimer disease patients, is related to the pathological process underlying Alzaheimer disease. PMID: 25408215 CCR6 SNPs are a risk factor for presence of anti-topoisomerase I antibodies in systemic sclerosis. PMID: 26314374 CCL20 cooperated with CCR6 could recruit T regulatory cells to tumor sites, and chemotherapy medicine docetaxel could decrease the expression of CCL20. PMID: 25661365 hBD-3 stimulates IL-37 expression through CCR6 in keratinocytes PMID: 25541254 RNASET2 tag SNP but not CCR6 polymorphisms is associated with autoimmune thyroid diseases in the Chinese Han population PMID: 25928629 PLZF regulates CCR6 and is critical for the acquisition and maintenance of the Th17 phenotype in human cells. PMID: 25833398 CKR-L3 with other minor coreceptors may contribute to HIV and SIV pathogenesis including dissemination, trafficking and latency especially when major coreceptors become compromised. PMID: 24980635 These findings support the hypothesis that CCR6 up-regulation stimulated by IL-17 may play an active role in colorectal cancer cell migration. PMID: 25201147 The tumor expression of CCR6 plays a critical role in colorectal cancer metastasis. PMID: 24979261 CCR6/CCL20 biological axis increased the capacity of proliferation and adhesion, as well as the chemotactic migration and the level of cytokines related to degraded extracellular matrix. PMID: 24743888 genetic and biological role of the C-C chemokine ligand CCL20 and the C-C chemokine receptor CCR6in rheumatoid arthritis, is discussed.[review] PMID: 24394994 CCR6 is highly expressed in thyroid cancer cells.CCR6 promotes the invasion and migration of thyroid cancer cells via NF-kappa B signaling-induced MMP-3 production. PMID: 24984269 CCR6+ naive precursors contain a predetermined reservoir to replenish IL-17-secreting cells and may have implications in balancing the Th17 effector and IL-17+ Treg compartments that are perturbed during HIV infection. PMID: 24958901 CCR6 protein level was higher in hepatocellular carcinoma (HCC) than in adjacent noncancerous tissues. CCR6 expression correlated with multicentricity and vascular invasion. CCR6 expression was an independent prognostic factor for overall survival. PMID: 24634224 CCR6 expression is regulated by miR-518a-5p in colorectal cancer cells. PMID: 24559209 DPP4, CDK5RAP2, and CCR6 are risk loci for rheumatoid arthritis in Han Chinese and congruence with risk variants in Europeans. PMID: 24782177 interfering with IL-1beta and IL-12 signaling in Th17 cells during inflammation may be a promising therapeutic approach to reduce their differentiation into "pathogenic" CCR6+ CXCR3+ Th1/17 cells in patients with autoimmune diseases. PMID: 24890729 Dendritic and T cells in psoriasis express CCL20 and CCR6 as part of the pathology. PMID: 24401998 High CCR6/CCR7 expression and Foxp3 positive T regulatory cell number are positively related to the progression of laryngeal squamous cell carcinoma PMID: 23835793 A CCR6 variant strongly associated with rheumatoid arthritis in two populations is not associated with ankylosing spondylitis. PMID: 22527137 Chemokine receptor CCR6-dependent accumulation of gammadelta T cells in injured liver restricts hepatic inflammation and fibrosis. PMID: 23959575

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.