Recombinant Human C-C Chemokine Receptor Type 1 (CCR1) Protein (His-SUMO)

Name: Recombinant Human C-C Chemokine Receptor Type 1 (CCR1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-07056P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human C-C Chemokine Receptor Type 1 (CCR1) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P32246
Target Symbol	CCR1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	ERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF
Expression Range	306-355aa
Protein Length	Partial
Mol. Weight	18.9 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for a C-C type chemokine. Binds to MIP-1-alpha, MIP-1-delta, RANTES, and MCP-3 and, less efficiently, to MIP-1-beta or MCP-1 and subsequently transduces a signal by increasing the intracellular calcium ions level. Responsible for affecting stem cell proliferation.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 1602 OMIM: 601159 KEGG: hsa:1230 STRING: 9606.ENSP00000296140 UniGene: Hs.301921
Tissue Specificity	Widely expressed in different hematopoietic cells.

Gene Functions References

The polymorphism of CCR1 rs3733096 and CCL5 rs3817656 are associated with spontaneous clearance of hepatitis C virus in Chinese Han population. PMID: 29703961
Data suggest that CCR1 gene may be a putative marker of molecular activity of Crohn's disease. PMID: 29556615
Results reveal that CCR1 expression is positively correlated with OPN expression in hepatocellular carcinoma cells, and the patients with high levels of both OPN and CCR1 have the most dismal prognosis. Study also, shows that steopontin upregulates CCR1 in HCC cells and, that CCR1 is essential for osteopontin-induced HCC metastasis. PMID: 29285854
Expression of CCR1 was measured in retrospective clinical specimens of colorectal cancer lung metastases. CCR1+ cells accumulated around the CCL15-positive colorectal cancer cells in the lung, but few around the CCL15-negative ones. PMID: 27492974
during renal transplantation, CD4+ and CD8+ T cells expressing CCR1 were increased in patients who developed renal allograft dysfunction PMID: 27234431
MIP-1alpha receptor antagonism can significantly reduce T cell migration to the secreted factors from Oesophagogastric adenocarcinoma omentum and liver. PMID: 27046081
These data suggest that CCR1/CCR2B could be involved in clearing EBV-infected latency III B cells in immunocompetent individuals via directing the migration of these cells and attracting the chemokines-expressing immune cells. PMID: 28892735
Data suggest that the interplay between CCR1 upregulation and inactivation of CXCR4 signaling (the CCR1/CXCR4 axis) drives the egress of multiple myeloma PCs from the bone marrow, leading to disease dissemination. PMID: 28855206
Basophil migration into skin lesions of Systemic Lupus Erythematosus patients were observed, but not in normal skin tissue. This migration was related to the upregulation of chemokine receptors CCR1 and CCR2 on basophils. PMID: 28954264
Study indicates that two distinct micro-environmental factors, CD40L and Mphis, signal via CCR1 to induce AKT activation resulting in translational stabilization of MCL-1, and hence can contribute to CLL cell survival. PMID: 28192408
CCL15 activation of CCR1 plays critical roles in hepatocellular carcinoma metastasis. PMID: 26501423
CCL15-positive primary colorectal cancers recruited approximately 2.2 times more numbers of CCR1(+) cells. PMID: 26341919
The residues on the N-loop and beta-sheets of MIP-1a are close to both CCR1 and CCR5, and those in the C-terminal helix region are close to CCR5. PMID: 26472202
Results highlight the potential role of CCR genes in narcolepsy and support the hypothesis that patients with narcolepsy have impaired immune function. PMID: 25986216
CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 are bona fide susceptibility genes for Behcet's disease. PMID: 26097239
This study reveled that CCR1 having a central role in the bipolar disease and schizophrenia manifestation. PMID: 25487697
Identifying bias in CCR1 antagonists using radiolabelled binding, receptor internalization, beta-arrestin translocation and chemotaxis assays PMID: 24990525
These results suggest that increased CC-chemokine receptor expression may play a role in the pathogenesis of adenomyosis. PMID: 24599574
Our results confirm the strong influence of previous immunity in subsequent dengue infections, and confer a possible pathogenic role to CCR1 and CCL3 in dengue disease and a possible protective role for CCL5, probably through CCR5 interaction. PMID: 24157267
cross-desensitization of CCR1 by FPR1 was associated with CCR1 phosphorylation and moderate reduction of CCR1 cell-surface expression. In contrast, CCR2 was not phosphorylated or internalized after FPR1 activation. PMID: 24778447
Data suggest that CCL13 binds to several chemokine receptors (CCR1, CCR2, and CCR3), allowing CCL13 to elicit different effects on its target cells of the immune system. CCL13/CCR1 signal transduction is key step in asthma progression. [REVIEW] PMID: 23846739
the interaction of CCR1 with CCL5 caused by increased expression of CCR1 promotes invasion of PC3 Castration-refractory prostate cancer cells by increasing secretion of MMPs 2 and 9 and by activating ERK and Rac signaling. PMID: 23876400
CCR1.beta-arrestin-2 complex may be related to a potential scavenging function of the receptor, which may be important for maintenance of chemokine gradients and receptor responsiveness in complex fields of chemokines during inflammation. PMID: 24056371
Increased expression of CCR1 and CCR3 chemokine receptors may, in accord with various chemokines, contribute to the pathogenesis of nasal polyposis. PMID: 23054685
Cigarette smoking could increase the expression of CCR1 on the inflammatory cells. Both CCR1 and CCR5 expressions on the inflammatory cells in induced sputum could be associated with COPD severity. PMID: 23217400
Elevated immunoreactivity of RANTES and CCR1 correlate with the severity of stages and dysmenorrhea in women with deep infiltrating endometriosis. PMID: 23219091
Signaling via CCL5/CCR1 axis triggers migration of adipose tissue derived stromal cells, activates ERK and AKT kinases, stimulates NFkappaB transcriptional activity and culminates in increased proliferation of CCR1(+) cells. PMID: 23276697
These findings suggest that the increased expression of CCL3, CCR1, and CCR5 may influence the immune response in RAS by T(H)1 cytokine polarization. PMID: 22727097
The expression of chemokine receptor CCR1 on the immune cells in orbital tissue of thyroid associated ophthalmopathy patients is elevated. PMID: 22650026
The CCL3-CCR1 axis may play an important role in promoting macrophage infiltration in degenerated, herniated discs. PMID: 23233369
CCR1-mediated STAT3 tyrosine phosphorylation and CXCL8 expression in THP-1 macrophage-like cells involve pertussis toxin-insensitive Ga14/16 signaling and IL-6 release. PMID: 23125416
ten SNPs, located in 3'UTR, 5'UTR in CCR1 or 5'UTR in CCR3, were significantly associated with Behcet's disease PMID: 22829007
Data show parathyroid hormone-related protein (PTHrP) and macrophage inflammatory protein-1alpha (MIP-1alpha) exert antitumor effect presumably by increasing sensitivity to apoptotic signals through modulation of transcription and apoptosis factors in T-cells. PMID: 21942940
a bis-quinoline compound, (7-chloro-N-(4-(7-chloroquinolin-4-ylamino)butyl)quinolin-4-amine; RE-660) has C-C chemokine receptor type 1 (CCR1)-agonistic properties PMID: 22104149
The expression of chemokine receptor CCR1 is higher in the orbital fibroblasts of patients with thyroid associated ophthalmopathy than in normal controls. PMID: 22007486
TLR2 negatively regulates CCR1, CCR2, and CCR5 on blood monocytes by activating chemokine-dependent down-modulation and providing a molecular mechanism for inhibiting monocyte migration after pathogen recognition. PMID: 21148810
Above median expression of CXCR2, CXCR3 and CCR1 in the tumour islets is associated with increased survival in non-small cell carcinoma, and expression of CXCR3 correlates with increased macrophage and mast cell infiltration in the tumour islets. PMID: 20429924
CCR1 antagonist, BX471, did not significantly alter ICAM-3 expression in relapsing-remitting multiple sclerosis patients. PMID: 20086017
These data suggest that CCR1 may be useful for lymphoma classification and support a role for chemokine signaling in the pathogenesis of hematolymphoid neoplasia. PMID: 20154287
CCR1 were genes activated in late endometrial endometrioid carcinoma (stages III-IV). PMID: 20015385
The expression CCR1 in colorectal carcinoma is correlated with lymph node metastasis. PMID: 19664396
agonistic effect of truncated leukotactin-1 on receptor activity PMID: 11832479
We determined that human serum contains a molecule that suppresses RANTES (CCL5) binding to endothelial cells, PBMC and CHO cells. PMID: 11920567
CCR1, CCR6, and CXCR6 are preferentially expressed by the low cytokine-producing CD8 and CD4(-)CD8(-) subsets of natural killer T-cells. PMID: 12070001
chronic hepatitis C, but not hepatitis B, infection alters surface expression of CCR1 and CCR5 in T cells, resulting in lower CC chemokine responsiveness. PMID: 12085329
Selective CCL5/RANTES-induced mast cell migration through interactions with chemokine receptors PMID: 12270118
Potential interaction between this protein and it ligand, CCL3 is induced by endogenously produced interleukin-1 in human hepatomas. PMID: 12651617
Efficient leukocyte arrest in flow but not transmigration may thus require the presentation of RANTES oligomers to bridge surface-bound RANTES and CCR1. PMID: 12763925
Eosinophil CCR1 expression is non-normally distributed in atopics, although higher CCR1 expression levels are not predictive of a diagnosis of atopy or atopic disease. PMID: 12794150
Trophoblasts acquire CCR1 as they differentiate to an invasive phenotype at the villus-anchoring sites. PMID: 14530297

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.