Recombinant Human Butyrophilin Subfamily 3 Member A2 (BTN3A2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09316P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Butyrophilin Subfamily 3 Member A2 (BTN3A2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09316P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Butyrophilin Subfamily 3 Member A2 (BTN3A2) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P78410 |
Target Symbol | BTN3A2 |
Synonyms | BT3.2; BT3.3; BT3A2_HUMAN; BTF4; BTN3A 2; BTN3A2; Butyrophilin protein; Butyrophilin subfamily 3 member A2; Butyrophilin; subfamily 3; member A2; CD277; FLJ40011 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW |
Expression Range | 30-248aa |
Protein Length | Extracellular Domain |
Mol. Weight | 39.6kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Protein Families | Immunoglobulin superfamily, BTN/MOG family |
Database References | |
Tissue Specificity | Detected in T-cells and natural killer cells. |
Gene Functions References
- CpG-specific DNA methylation of ADAMTSL2 and BTN3A2 at rheumatoid arthritis diagnosis can serve as a marker of treatment response. PMID: 28447857
- BTN3A2 genetic variants have role in gastric carcinogenesis. PMID: 28246015
- BTN3A2 rs9104 was strongly associated with genotype 1 hepatitis C infection. PMID: 25928882
- Three SNPs in BTN3A2 were associated with schizophrenia, rs12214031, rs9393709 and rs12199613. There was no interaction between these SNPs and HSV-1, CMV or toxoplasma exposure. PMID: 22966150
- Results suggest that BT3.2 butyrophilin expression by epithelial cells may modulates the intratumoral infiltration of immune cells. PMID: 22685580
- our results identify PRSS16 and BTN3A2, two genes thought to play important roles in regulating the immune response, as potentially novel susceptibility genes for Type I Deabetes. PMID: 19295542