Recombinant Human Bone Sialoprotein 2 (IBSP) Protein (His-SUMO)

Name: Recombinant Human Bone Sialoprotein 2 (IBSP) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-02884P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Bone Sialoprotein 2 (IBSP) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P21815
Target Symbol	IBSP
Synonyms	BNSP; Bone sialoprotein 2; Bone sialoprotein II; BSP; BSP II; BSPII; Cell binding sialoprotein; Cell-binding sialoprotein; IBSP; Integrin binding sialoprotein; Integrin-binding sialoprotein; SIAL_HUMAN; SPII
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESE
Expression Range	129-281aa
Protein Length	Partial
Mol. Weight	32.4kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment.
Subcellular Location	Secreted.
Database References	HGNC: 5341 OMIM: 147563 KEGG: hsa:3381 STRING: 9606.ENSP00000226284 UniGene: PMID: 27881474 In conclusion, serum levels of BSP, ALP, ICTP, and PSA increased in patients with bone metastases, and combined detection of all markers could improve the positive-predictive value. PMID: 27323113 Preameloblast-Derived Factors Mediate Osteoblast Differentiation of Human Bone Marrow Mesenchymal Stem Cells by Runx2-Osterix-BSP Signaling. PMID: 26413977 Two significant SNPs within IBSP, rs1054627 and rs17013181, were associated with BMD and postmenopausal osteoporosis by the two-stage strategy, and rs17013181 was also significantly associated with serum IBSP levels. PMID: 26568273 Our results suggest that SSEA-4 is a specific cell surface antigen that can be used to identify dental pulp stem cells. PMID: 22266579 the strong correlation between bone sialoprotein and OPN and papillary thyroid carcinoma suggests a role for BSP and OPN in calcification and tumor progression of papillary thyroid carcinoma PMID: 25973097 oxidized low-density lipoprotein-induced expression dependent on Runx2 expression PMID: 25504218 Bone sialoprotein could be a key mediator of the hypertrophic chondrocytes-induced angiogenesis of osteoarthritis. PMID: 24530278 Current evidence demonstrates that BSP and OPN, play significant roles in bone metastasis of osteotropic malignancies derived from breast, prostate, lung, thyroid, and multiple myeloma. [review] PMID: 24071501 High expression of bone sialoprotein in breast neoplasms was associated with cytokeratin-positive cells in bone marrow, but not with lymph node metastasis. PMID: 23726130 results indicate that FGF2 increases BSP transcription by targeting the FRE and AP1 elements in the proximal promoter of the human BSP gene. PMID: 23485603 BSP silencing decreased the integrin alphavbeta3 and beta3 levels, in turn inhibiting cell migration and invasion and decreasing the ability of the cells to metastasize to bone. PMID: 23667544 IBSP mRNA is over expressed in carotid atheroma plaque (3.74 fold, p = 1.41E-09) in an intraindividual comparison. PMID: 23314561 High BSP expression occurs in a significant subset of high-grade glioma patients and predicts a poorer outcome PMID: 23119009 HTRA1 has a central role in osteogenesis through modification of proteins within the extracellular matrix, in particular, ibsp. PMID: 22865667 human primary cementoblasts subjected to compression and IL-1beta stimulation impeded BSP and CEMP-1 expression, proteins that are associated with cementogenesis. PMID: 22349547 OPN plasma levels are associated with the genetic polymorphisms in integrin-binding sialoprotein gene locus (IBSP) PMID: 20967421 BSP protein expression in the primary resected non-small-cell lung cancer is strongly associated with bone metastasis and could be used to identify high-risk patients. PMID: 19376608 RT-PCR analysis of human bone marrow stromal cells during osteogenesis in vitro: the mRNA levels of bone morphogenetic protein-2 (BMP-2), bone sialoprotein-II (BSP), osteopontin (OP) and cbfa-1 increased with culture time in osteogenic medium. PMID: 11968014 has RGD sequence, affinity to collagen, and induces mineral crystal formation PMID: 11979972 Osteoblast-related transcription factors Runx2 (Cbfa1/AML3) and MSX2 mediate the expression of bone sialoprotein in human metastatic breast cancer cells. PMID: 12750290 BSP is expressed in breast and prostate cancer and has a role as a stimulator of bone mineralisation PMID: 14524533 The time course of the expression of BSP wss visualized after dental implnt implatation in mandibular bone fibroblasts. PMID: 15795688 Data show that RUNX2 is a direct regulator of bone sialoprotein in osteoblasts and that it functions in cooperation with DLX5 or a related factor to activate osteoblast-specific gene expression. PMID: 16000302 Bone sialoprotein is involved in migration of bone marrow stromal cells through Matrigel and collagen barriers. PMID: 16995818 bone sialoprotein expression in the primary resected NSCLC is strongly associated with BM progression and could be useful in identifying high-risk patients who could benefit from novel modalities of surveillance and preventive treatment PMID: 17050866 May be a prognostic marker for bone metastasis in breast cancer. PMID: 17213971 Runx2 and HDAC3 repress BSP gene expression and that this repression is suspended upon osteoblastic cell differentiation. PMID: 17956871 has an angiogenic capacity; important in the differentiation of osteoblasts, bone matrix mineralization and tumor metastasis [review] PMID: 18302613 PTH stimulates human BSP gene transcription by targeting the two cAMP response elements in the promoter of the human BSP gene. PMID: 19127545 Studies do not support a role for BSP in promoting metastasis through interactions with pro-MMP-2. PMID: 19386107 cooperative mechanisms by which BSP can enhance specific factors associated with a metastatic phenotype in tumor cell lines, an effect that is increased by circulating TGF-beta1 and EGF. PMID: 19492334 Eight threonines modified by O-glycans were identified, leaving the C terminus of the protein free of glycans. The recombinant protein showed similar secondary structures as bone-derived BSP PMID: 11459848

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.