Recombinant Human Bone Morphogenetic Protein Receptor Type-1A (BMPR1A) Protein (His-SUMO)

Name: Recombinant Human Bone Morphogenetic Protein Receptor Type-1A (BMPR1A) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09784P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, High-quality recombinant proteins, Kinase

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Bone Morphogenetic Protein Receptor Type-1A (BMPR1A) Protein (His-SUMO) is produced by our E.coli expression system. This is a cytoplasmic protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P36894
Target Symbol	BMPR1A
Synonyms	10q23del; Activin A receptor type II like kinase 3; Activin receptor like kinase 3; Activin receptor-like kinase 3; ACVRLK 3; ACVRLK3; ALK 3; ALK-3; ALK3; BMP type-1A receptor; BMPR 1A; Bmpr; BMPR-1A; Bmpr1a; BMR1A_HUMAN; Bone morphogenetic protein receptor type IA; Bone morphogenetic protein receptor type IA precursor; Bone morphogenetic protein receptor type-1A; BR 1a; BR1a; CD 292; CD292; CD292 antigen; EC 2.7.11.30; Serine threonine protein kinase receptor R5; Serine threonine protein kinase receptor R5 precursor; Serine/threonine-protein kinase receptor R5; SKR 5; SKR5; zBMPR IA; zBMPRIA
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	KHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
Expression Range	177-532aa
Protein Length	Cytoplasmic Domain
Mol. Weight	56.6kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP2, BMP4, GDF5 and GDF6. Positively regulates chondrocyte differentiation through GDF5 interaction. Mediates induction of adipogenesis by GDF6.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Cell surface.
Protein Families	Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Database References	HGNC: 1076 OMIM: 174900 KEGG: hsa:657 STRING: 9606.ENSP00000224764 UniGene: PMID: 29458345 BMPR1A mutation in superior coloboma PMID: 29522511 Knockdown of BMPR1a of breast cancer cells suppresses their production of RANKL via p38 pathway and inhibits cancer-induced osteoclastogenesis. PMID: 29495003 BMPR1A and the ubiquitous isoform of BMPR1B differed in mode of translocation into the endoplasmic reticulum; and (ii) BMPR1A was N-glycosylated while BMPR1B was not, resulting in greater efficiency of processing and plasma membrane expression of BMPR1A. PMID: 28357470 Several germline variants in Hamartomatous Polyposis Syndrome genes were detected, among them three in ENG, two in BMPR1A, one in PTEN, and one in SMAD4. Although some of the detected variants have been reported previously none could be definitely pathogenic or likely pathogenic. PMID: 27146957 The present study suggests that HNF-4alpha has a suppressive effect on hepcidin expression by inactivating the BMP pathway, specifically via BMPR1A, in HepG2 cells. PMID: 27660075 Data show that protein kinase LKB1 physically interacts with BMP type I receptors and requires Smad7 protein to promote downregulation of the receptor. PMID: 26701726 BMPR1A(+) ASCs show an enhanced ability for adipogenesis in vitro, as shown by gene expression and histological staining. PMID: 26585335 Duplication of 10q22.3-q23.3 encompassing BMPR1A gene is associated with congenital heart disease, microcephaly, and mild intellectual disability PMID: 26383923 Authors analyzed human databases from TCGA and survival data from microarrays to confirm BMPR1a tumor promoting functions, and found that high BMPR1a gene expression correlates with decreased survival regardless of molecular breast cancer subtype. PMID: 26274893 About half of BMPR1A-related polyps displayed loss of heterozygosity, predominantly in the epithelial compartment, compatible with BMPR1A acting as a tumour suppressor gene. PMID: 26171675 Results support a novel role for miR-885-3p in tumor angiogenesis by targeting BMPR1A, which regulates a proangiogenic factor. PMID: 24882581 Decreased expression of BMPR1A was associated malignant gallbladder lesions. PMID: 23531103 The mRNA/protein expressions of BMPR1alpha was higher in the stenotic colon segment tissue than in the normal colon segment tissue of Hirschsrung disease patients. PMID: 24966941 High BMPR1A expression is associated with glioma tumorigenesis. PMID: 24480809 Data show that USP15 enhances BMP-induced phosphorylation of SMAD1 by interacting with and deubiquitylating ALK3. PMID: 24850914 This is the first case report to document coding exon 3 duplication in the BMPR1A gene in a patient with juvenile polyposis syndrome. PMID: 25129392 results provide evidence that HFE induces hepcidin expression via the BMP pathway: HFE interacts with ALK3 to stabilize ALK3 protein and increase ALK3 expression at the cell surface. PMID: 24904118 BMP15 down-regulates StAR expression and decreases progesterone production in human granulosa cells, likely via ALK3-mediated SMAD1/5/8 signaling. PMID: 24140593 BMPR1a and BMPR2 are downregulated in cardiac remodeling and heart failure PMID: 24398041 Bone morphogenetic protein receptor type 1A missense mutations occurring in patients with juvenile polyposis affected cellular localization in an in vitro model. PMID: 23433720 findings show that a reduction in the expression of BMPRIA is associated with a poorer prognosis in pancreatic cancer PMID: 23969729 BMP receptor antagonists and silencing of BMP type I receptors with siRNA induced cell death, inhibited cell growth, and caused a significant decrease in the expression of inhibitor of differentiation (Id1, Id2, and Id3) family members. PMID: 23593444 Seventy-seven patients (13%) were found to have colorectal polyposis-associated mutations, including 20 in BMPR1A (3.3%) PMID: 23399955 Results suggest that rs7922846 BMPR1A polymorphism may account for subtle variation in kidney size at birth, reflecting congenital nephron endowment. PMID: 22886282 lack of associations between LVM, values of blood pressure, and the BMP4, BMPR1A, BMPR1B, and ACVR1 genotypes PMID: 22971142 These data support the role of BMPR-1A as an indicator ofosteoarthritis progression in human knees with circumscribed cartilage lesions. PMID: 22519633 Crystals of GDF5 and BMP receptor IA complex belonged to a monoclinic space group: either I2, with unit-cell parameters a = 63.81, b = 62.85, c = 124.99 A, beta = 95.9 degrees , or C2, with unit-cell parameters a = 132.17, b = 62.78, c = 63.53 A, beta = 112.8 degrees PMID: 21543859 generation of TGF-beta and BMP receptor homo- and hetero-oligomers and its roles as a mechanism capable of fast regulation of signaling by these crucial cytokines [review] PMID: 22293501 analysis of promiscuity and specificity in BMP receptor activation [review] PMID: 22710174 Sp1 was found to be a candidate factor that likely plays a role in the transcriptional regulation of BMPR1A. PMID: 21872883 Letter: Report the phenotypic spectrum of BMPR1A mutations in hereditary nonpolyposis colorectal cancer without mismatch repair deficiency. PMID: 21640116 Data show that blocking both endogenous BMPR1A and BMPR1B almost offset the effect of BMP7 on the proliferation of NCI-H460 cell completely. PMID: 20673479 Juvenile polyps with a SMAD4 germline mutation were predominantly type B, whereas type A was more common among juvenile polyps with a BMPR1A germline mutation. PMID: 21412070 identified the promoter for BMPR1A, in which mutations may be responsible for as many as 10% of juvenile polyposis cases with unknown mutations PMID: 20843829 BMPR1A were detected in the human retina and retinoblastoma cell lines. PMID: 21152263 Crystals BMP receptor type IA bound to the antibody Fab fragment belonged to the monoclinic space group P2(1), with unit-cell parameters a=89.32, b=129.25, c=100.24 A, beta=92.27 degrees PMID: 20693682 we describe the significance of a bone morphogenetic protein receptor type 1A gene mutation in an Irish family with hereditary mixed polyposis syndrome. PMID: 19438883 Germline BMPR1A defect is the disease-causing mutation in 50% of the HMPS families. PMID: 19773747 BMPR1A can act as a minor susceptibility gene for PTEN mutation negative Cowden syndrome PMID: 12620973 BMPR-IA may interact with and modulate the activity of a developmentally relevant splicing factor PMID: 15351706 A defect in BMPRIA internalization and increased activation of downstream signaling, suggesting that altered BMP receptor trafficking underlies ectopic bone formation in fibrodysplasia ossificans progressiva. PMID: 15940369 BMPR1A is a promising marker for evaluating ganglion cells in the enteric nervous system. PMID: 16226113 Human granulosa-like tumor cell line KGN expressed BMP type I (BMPR1A and BMPR1B) and type II receptors (BMPR2) and the BMP signaling molecules SMADs (SMAD1 and SMAD5). PMID: 16436528 BMPR1A mutation accounts for hereditary mixed polyposis syndrome and inactivating this gene can initiate colorectal tumourigenesis PMID: 16525031 Cooperation between this gene and PTEN gene is deleted on chromoome 10 in juvenile polyposis coli. PMID: 17101085 SF3b4, known to be localized in the nucleus and involved in RNA splicing, binds BMPR-IA and specifically inhibits BMP-mediated osteochondral cell differentiation PMID: 17513295 Linkage analysis suggested a cryptic BMPR1A mutation or the presence of another gene in close proximity to the BMPR1A locus. PMID: 17573831 5 nonsense, 2 frameshift, 4 missense and 2 splice site mutations were associated with juvenile polyposis syndrome. A 65-BP deletion in intron 4 included -2 of the splice acceptor side of exon 5. PMID: 17873119 Large genomic deletions of SMAD4, BMPR1A and PTEN are a common cause of JPS. PMID: 18178612

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.