Recombinant Human Bone Morphogenetic Protein 6 (BMP6) Protein (His)

Name: Recombinant Human Bone Morphogenetic Protein 6 (BMP6) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03575P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Bone Morphogenetic Protein 6 (BMP6) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P22004
Target Symbol	BMP6
Synonyms	BMP-6; Bmp6; BMP6_HUMAN; Bone morphogenetic protein 6; Bone Morphogenic Protein 6; Decapentaplegic vegetal related; DVR6; HGNC:12686; TGFB related vegetal related growth factor; Transforming growth factor beta; Vegetal related (TGFB related) cytokine; Vegetal related growth factor (TGFB related); Vg related sequence; VG-1-R; VG-1-related protein; Vg1 related sequence; VGR; VGR-1; VGR1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	QQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
Expression Range	382-513aa
Protein Length	Partial
Mol. Weight	18.9kDa
Research Area	Developmental Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes including cartilage and bone formation. Plays also an important role in the regulation of iron metabolism by acting as a ligand for hemojuvelin/HJV. Initiates the canonical BMP signaling cascade by associating with type I receptor ACVR1 and type II receptor ACVR2B. In turn, ACVR1 propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target. Can also signal through non-canonical pathway such as TAZ-Hippo signaling cascade to modulate VEGF signaling by regulating VEGFR2 expression.
Subcellular Location	Secreted.
Protein Families	TGF-beta family
Database References	HGNC: 1073 OMIM: 112266 KEGG: hsa:654 STRING: 9606.ENSP00000283147 UniGene: PMID: 29767257 Study demonstrated that the mesenchymal epithelial/myoepithelial potential of transdifferentiation of the luminal cells that make up the proliferative units is certified by the immunohistochemical expression of some BMP6 purely mesenchymal protein cells. PMID: 28523310 Plasma BMP6 was significantly increased in chronic heart failure patients. PMID: 27592865 Our results independently add further evidence to the role of BMP6 mutations as likely contributing factors to late-onset moderate IO unrelated to mutations in the established five HH genes. PMID: 28335084 Further investigation on clinical ESCC samples and non-tumorous adjacent tissue found that tumors with triple-positive BMP6, ALK2 and BMPRII had deeper growth than tumors with only BMP6 expression PMID: 27959431 the combined delivery of VEGF and BMP-6 to the bone defect significantly enhanced bone repair through the enhancement of angiogenesis and the differentiation of endogenously recruited MSCs into the bone repair site. PMID: 26475719 the patients carried genotype TA of rs 267196 and genotype AG of rs267201 present a high risk factor for developing osteonecrosis RR=1.317 and RR=1.3 respectively PMID: 24263212 BMP-6 upregulates somatostatin receptor actions, leading to reduction of GnRH-induced secretion of luteinizing hormone. PMID: 26779985 These observations suggest a novel role of BMP-6 in the inhibition of breast cancer metastasis by regulating secretion of MMPs(MMP-1) in the tumor microenvironment. PMID: 26751737 BMP-dependent physical interaction of VE-cadherin with the BMP receptor ALK2 (BMPRI) and BMPRII, resulting in stabilization of the BMP receptor complex and, thereby, the support of BMP6-Smad signaling. PMID: 26598555 BMP6 and oxidized low-density lipoprotein independently and synergistically induced osteogenic differentiation and mineralization in vascular endothelial cells. PMID: 26410368 Identify 3 heterozygous missense mutations in BMP6 in patients with unexplained iron overload. These mutations lead to loss of signaling to SMAD proteins and reduced hepcidin production. PMID: 26582087 These results demonstrated that Hcy up-regulated hepcidin expression through the BMP6/SMAD pathway, suggesting a novel mechanism underlying the hyperhomocysteinemia-associated perturbation of iron homeostasis. PMID: 26855134 demonstrate that BMP6 is associated with radiographic severity in AS, supporting the role wingless-type like/BMP pathway on radiographic progression in AS PMID: 25121767 These observations imply that crosstalk between the VEGF and BMP-6 signaling pathways enhances osteogenic differentiation of MSCs. PMID: 25753222 In vitro analysis revealed that recombinant BMP6 inhibited the activation of hepatic stellate cells (HSCs) and reduced proinflammatory and profibrogenic gene expression in already activated HSCs PMID: 25011936 CpG island methylation of BMP6 is found in high frequency in CRC and this epigenetic event is associated with suppressed protein expression in the tumor tissue. PMID: 25227796 BMP-6 attracted neutrophils and controlled the regulation of the neutrophils in the ovary. PMID: 24406789 Data indicated that hypermethylation modifications contributed to the regulation of BMP6 and induced an epithelial-to-mesenchymal transition phenotype of breast cancer during the acquisition of drug resistance. PMID: 24890613 BMP-6 secreted by prostate cancer cells induces IL-6 expression in macrophages; IL-6, in turn, stimulates the neuroendocrine differentiation of prostate cancer cells. PMID: 21374653 these data highlight a therapeutically innovative role for BMP6 by providing a means to enhance the amount of myogenic lineage derived brown fat. PMID: 24658703 There were no correlations between iron parameters and the expression of the BMP-6 in granulosa cells from polycycstic ovary syndrome patients. PMID: 24875397 The BMP-6 staining intensity was downregulated. PMID: 24498236 WNT5A derived from bone stromal cells induced the expression of BMP-6 by CaP cells; BMP-6 in turn stimulated cellular proliferation of CaP cells. PMID: 24518599 Marker gene screening for human mesenchymal stem cells in early osteogenic response to bone morphogenetic protein 6 with DNA microarray. PMID: 23799295 Prostate cancer-derived BMP-6 stimulates tumor-associated macrophages to produce IL-1a through a crosstalk between Smad1 and NF-kB1; IL-1a, in turn, promotes angiogenesis and prostate cancer growth. PMID: 24185914 High BMP6 expression is associated with breast cancer. PMID: 24012720 BMP6 plays a critical role in breast cancer cell aberrant proliferation and chemoresistance and may serve as a novel diagnostic biomarker or therapeutic target for breast cancer. PMID: 23674072 Estrogen is involved in hepcidin expression via a GPR30-BMP6-dependent mechanism PMID: 22792339 investigated role of BMP6 in esophageal squamous cell carcinoma (SCC) development and progression;high BMP6 activity, defined by strong BMP6 expression with weak noggin or SOST expression, was associated with shorter survival in esophageal SCC patients; results suggest BMP6, noggin and SOST could be used in combination as a prognostic indicator in cancer progression PMID: 22364398 Results suggest that PTHrP (ParaThyroid Hormone-related Protein) acts upstream of BMP-6, and exerts its antimitogenic effect by reducing BMP-6 mRNA expression through PKA signaling pathway in breast cancer cells. PMID: 20401668 The methylation of BMP6 was correlated with decreased levels of mRNA transcripts. PMID: 22086350 Growth differentiation factor 3 is induced by bone morphogenetic protein 6 (BMP-6) and BMP-7 and increases luteinizing hormone receptor messenger RNA expression in human granulosa cells. PMID: 22305102 BMP-6 mainly inhibited plasmablast differentiation, and BMP-7 mainly induced apoptosis in human memory B cells PMID: 21898381 BMP6 and iron not only induce hepcidin expression but also induce TMPRSS6, a negative regulator of hepcidin expression PMID: 21622652 a novel role of BMP-6/HO-1 cascade to relieve breast cancer metastasis by regulating the secretion of growth factors in tumor microenvironment. PMID: 21136273 AGTR1 gene deletion is associated with congenital anomalies of the kidneys and urinary tract. PMID: 20605837 the cBMP6 mRNA and H3K27me3 levels revealed significant differences between patients with local local advanced, or metastatic disease PMID: 20573596 Ass-associated increases in BMP6 expression in a transgenic mouse model of Alzheimer's disease may have deleterious effects on neurogenesis in the hippocampus. PMID: 20844121 BMP6, Smad1, Smad2 mRNA and protein expression were significantly higher in during sickle-cell pathology with orthopedic complications. PMID: 20460105 Using BMP-6/7 chimeras, we identified lysine 60 as a key residue conferring noggin resistance within the BMP-6 protein. PMID: 20048150 Malignant human clear cell renal carcinoma tissue had significantly higher BMP-6 mRNA expression than healthy tissue PMID: 20016212 regulates hepcidin an iron metabolism in humans PMID: 19765379 the presence of BMP-6 in adult human articular cartilage indicates a functional role for this growth factor in the maintenance of joint integrity. PMID: 13130469 BMP-6 increases the levels of osteopontin, BMP-2, alkaline phosphatase and core binding factor alpha 1 mRNAs in human periodontal (HPL) ligament cells. PMID: 15516325 Recombinant noggin inhibited the function of BMP-6, suggesting a negative feedback regulation of BMP activity and indicating a strategy for the development of a novel therapeutic target in treatment of osteosclerotic bone metastases of prostate cancer PMID: 15548695 several single nucleotide polymorphisms in bone morphogenic protein 6, annexin A2, and klotho were associated with sickle cell osteonecrosis PMID: 15784727 In mature human B cells, BMP-6 inhibited cell growth, and rapidly induced phosphorylation of Smad1/5/8 followed by an upregulation of Id1. PMID: 15877825 endogenous BMP-6 system plays critical roles in aldosterone production between Ang II and K through ERK signaling pathway. PMID: 16527843 Excess numbers of BMP6-deficient myofibroblast progenitor cells may favour adverse tissue remodelling in patients with diabetes. PMID: 16547600

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.