Recombinant Human Bone Morphogenetic Protein 4 (BMP4) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04336P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Bone Morphogenetic Protein 4 (BMP4) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04336P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Bone Morphogenetic Protein 4 (BMP4) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P12644 |
Target Symbol | BMP4 |
Synonyms | zgc:100779; BMP 2B; BMP 4; BMP-2B; BMP-4; BMP2B; BMP2B1; BMP4; BMP4_HUMAN; Bone morphogenetic protein 2B; Bone morphogenetic protein 4; DVR4; MCOPS6; MGC100779; OFC11; zbmp-4; ZYME |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Expression Range | 293-408aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 29.1kDa |
Research Area | Developmental Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes, including neurogenesis, vascular development, angiogenesis and osteogenesis. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. Initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2. Once all three components are bound together in a complex at the cell surface, BMPR2 phosphorylates and activates BMPR1A. In turn, BMPR1A propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Can also signal through non-canonical BMP pathways such as ERK/MAP kinase, PI3K/Akt, or SRC cascades. For example, induces SRC phosphorylation which, in turn, activates VEGFR2, leading to an angiogenic response. |
Subcellular Location | Secreted, extracellular space, extracellular matrix. |
Protein Families | TGF-beta family |
Database References | HGNC: 1071 OMIM: 112262 KEGG: hsa:652 STRING: 9606.ENSP00000245451 UniGene: PMID: 30079292 |