Recombinant Human Bone Morphogenetic Protein 15 (BMP15)
Recombinant Human Bone Morphogenetic Protein 15 (BMP15)
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Bone Morphogenetic Protein 15 (BMP15) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O95972 |
| Target Symbol | BMP15 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Target Protein Sequence | QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR |
| Expression Range | 268-392aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 14.1 kDa |
| Research Area | Developmental Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth. |
| Subcellular Location | Secreted. |
| Protein Families | TGF-beta family |
| Database References | HGNC: 1068 OMIM: 300247 KEGG: hsa:9210 STRING: 9606.ENSP00000252677 UniGene: PMID: 30039232 |
