Recombinant Human Bone Marrow Proteoglycan (PRG2) Protein (His-GST)

Name: Recombinant Human Bone Marrow Proteoglycan (PRG2) Protein (His-GST)
Brand: Beta LifeScience
SKU: BLC-01648P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Bone Marrow Proteoglycan (PRG2) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P13727
Target Symbol	PRG2
Synonyms	PRG2; MBP; Bone marrow proteoglycan; BMPG; Proteoglycan 2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-GST
Target Protein Sequence	LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGC
Expression Range	17-104aa
Protein Length	partial
Mol. Weight	41.2 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
Subcellular Location	[Bone marrow proteoglycan]: Secreted. Note=The proform is secreted.; [Eosinophil granule major basic protein]: Cytoplasmic vesicle, secretory vesicle. Note=The proform is secreted. The mature protein is found in the matrix of the eosinophil's large specific granule (crystalloid core).
Database References	HGNC: 9362 OMIM: 605601 KEGG: hsa:5553 STRING: 9606.ENSP00000312134 UniGene: PMID: 29936783 MBP-1 aggregation is important for innate immunity and immunopathology mediated by eosinophils.MBP-1 toxicity is restrained via crystallization in eosinophil secretory granules. PMID: 25728769 free protein in nasal mucus can be used as a biomarker to diagnose chronic rhinosinusitis PMID: 25266917 mRNA levels of eosinophil granule proteins, rather than sputum eosinophil%, may reflect airway hyperresponsiveness and airflow limitation. PMID: 24814827 This protein contains a peptide that displays strong antibacterial activity against Gram-positive bacteria, Gram-negative bacteria, and fungi. PMID: 319906 Eosinophil major basic protein activates human cord blood mast cells primed with fibroblast membranes by integrin-beta1. PMID: 24112102 During pregnancy, the proform of eosinophil major basic protein-angiotensinogen constitutes the major form in late pregnancy. PMID: 23033876 Combinations of respiratory syncytial virus and MBP synergistically induced cell death in pulmonary alveolar epithelial cells (A549). PMID: 20977431 The expression of MBP in nasal mucus obtained from chronic rhinosinusitispatients was obviously higher than that of nasal mucus obtained from controls. PMID: 18720885 MBP and NE collaborated to cause the pathological effects of nasal polyps. PMID: 18476621 novel transcript was alternatively transcribed from intron III of the ENO1 gene and was feasible for MBP-1 production PMID: 20849415 The proMBP is a novel first trimester serum marker for adverse pregnancy outcome. PMID: 19626619 Transcription is regulated by novel combinatorial interactions of GATA-1, PU.1, and C/EBPepsilon isoforms. PMID: 12202480 IGF bioactivity is regulated by reversible cell surface binding of PAPP-A, which in turn is regulated by proMBP PMID: 12370176 MBP's structure is described, and its ability to bind to pregnancy-associated plasma protein A explained PMID: 12421832 Deposits of eosinophilic MBP are found on the surface of eosinophils and damaged muscle fibers surrounded by eosinophils in patients with idiopathic eosinophilic myositis. PMID: 12534990 MBP stimulates a Src kinase-dependent activation of class I(A) phosphoinositide 3-kinase and, in turn, activation of protein kinase C zeta in neutrophils, which contributes to the activation of NADPH oxidase and resultant superoxide production. PMID: 14500673 Proform of MPB forms a covalent complex with PAPPA in which PAPPA is inhibited. PMID: 14988014 the proform of eosinophil major basic protein inhibits the proteolytic activity of PAPP-A PMID: 15647258 two regions shown previously to contain the cytotoxic and cytostimulatory properties of MBP are accessible for ligand interaction in cell surface-bound MBP PMID: 16940047 Compared to MBP1, which is present in eosinophils, basophils, and a human mast cell line, homologous MBP2 is present only in eosinophils and may be a useful biomarker for eosinophil-associated diseases. PMID: 17082653 Pregnancy-associated plasma protein A is involved in processes preceding vulnerable plaque development in acute coronary syndrome. PMID: 17223728 knockdown of endogenous MBP-1 is involved in cellular senescence of HFF through p53-p21 pathway. PMID: 18852884 No variation in genes major basic protein for Atopic dermatitis pathogenesis in this German cohort PMID: 19014520 The significantly elevated levels of proMBP in myelofibrosis patients implies that proMBP could be an important stromal cytokine in bone marrow fibrosis. PMID: 19039208 addition to granule-stored MBP, even unstimulated eosinophils contained appreciable amounts of MBP within secretory vesicles PMID: 19398958

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.