Recombinant Human BNP Protein
Beta LifeScience
SKU/CAT #: BL-0369PS
Recombinant Human BNP Protein
Beta LifeScience
SKU/CAT #: BL-0369PS
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Tag | N/A |
Host Species | Human |
Synonym | NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide. |
Background | Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function. |
Description | B-type Natriuretic Peptide Human is a polypeptide chain containing 32a.a. and having a molecular weight of 3464 Dalton. The molecular formula is:C143H244N50O42S4. |
Source | Native |
AA Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH. |
Purity | >95.0% as determined by RP-HPLC. |
Endotoxin | <1.0 EU per μg by the LAL method. |
Formulation | The protein was lyophilized without additives. |
Stability | Recombinant protein is stable for 12 months at -70°C |
Usage | For Research Use Only |
Storage | Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |