Recombinant Human BMP9 Protein
Beta LifeScience
SKU/CAT #: BLA-0175P
Recombinant Human BMP9 Protein
Beta LifeScience
SKU/CAT #: BLA-0175P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Host Species | Human |
| Accession | Q9UK05 |
| Synonym | BMP 9 Bone morphogenetic protein 9 GDF 2 GDF2 growth differentiation factor 2 Growth/differentiation factor 2 HHT5 |
| Description | Recombinant Human BMP9 Protein was expressed in Wheat germ. It is a Full length protein |
| Source | Wheat germ |
| AA Sequence | MCPGALWVALPLLSLLAGSLQGKPLQSWGRGSAGGNAHSPLGVPGGGLPE HTFNLKMFLENVKVDFLRSLNLSGVPSQDKTRVEPPQYMIDLYNRYTSDK STTPASNIVRSFSMEDAISITATEDFPFQKHILLFNISIPRHEQITRAEL RLYVSCQNHVDPSHDLKGSVVIYDVLDGTDAWDSATETKTFLVSQDIQDE GWETLEVSSAVKRWVRSDSTKSKNKLEVTVESHRKGCDTLDISVPPGSRN LPFFVVFSNDHSSGTKETRLELREMISHEQESVLKKLSKDGSTEAGESSH EEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKE YEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSP ISVLYKDDMGVPTLKYHYEGMSVAECGCR |
| Molecular Weight | 74 kDa including tags |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |
Target Details
| Target Function | Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG. |
| Subcellular Location | Secreted. |
| Protein Families | TGF-beta family |
| Database References | HGNC: 4217 OMIM: 605120 KEGG: hsa:2658 STRING: 9606.ENSP00000249598 UniGene: PMID: 29650961 |
