Recombinant Human Bh3-Like Motif-Containing Cell Death Inducer (BLID) Protein (GST)

Name: Recombinant Human Bh3-Like Motif-Containing Cell Death Inducer (BLID) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08794P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Bh3-Like Motif-Containing Cell Death Inducer (BLID) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q8IZY5
Target Symbol	BLID
Synonyms	BH3-like motif containing; cell death inducer; BH3-like motif-containing cell death inducer; BLID; BLID_HUMAN; BRCC2; breast cancer cell 2; Breast cancer cell protein 2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
Expression Range	1-108aa
Protein Length	Full Length
Mol. Weight	39.0kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.
Subcellular Location	Cytoplasm. Mitochondrion. Note=Lower abundance in mitochondrion than in cytoplasm.
Database References	HGNC: 33495 OMIM: 608853 KEGG: hsa:414899 STRING: 9606.ENSP00000453153 UniGene: PMID: 25728273 loss of BLID may contribute to the progression of intraductal proliferation lesions to breast cancer. PMID: 24532431 BRCC2 functions as a novel tumor suppressor in breast cancer and may be a potential therapeutic target for breast cancer management. PMID: 23928696 Frequent loss of the BLID gene is observed in early-onset breast cancer. PMID: 21846966 Tag single nucleotide polymorphisms near the BLID and LOC399959 genes are not susceptibility loci for high myopia in the Chinese Han population. PMID: 21031016 BLID upregulation resulting from a novel IGH translocation is associated with childhood B-Cell precursor acute lymphoblastic leukemia. PMID: 20544842 BLID is a new binding partner of Bcl-X(L) and a significant prognostic factor in breast cancer PMID: 20400521 BRCC2 is a novel BH3-like domain-containing protein which induces apoptosis in a caspase-dependent manner PMID: 15069058 BLID gene is assigned to 11p24.1. PMID: 18940476 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 19779542

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.