Recombinant Human Beta-Catenin-Interacting Protein 1 (CTNNBIP1) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08702P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Beta-Catenin-Interacting Protein 1 (CTNNBIP1) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08702P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Beta-Catenin-Interacting Protein 1 (CTNNBIP1) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q9NSA3
Target Symbol CTNNBIP1
Synonyms Beta catenin interacting protein 1; Beta catenin interacting protein ICAT; Beta-catenin-interacting protein 1; Catenin beta interacting protein 1; CNBP1_HUMAN; CTNNBIP 1; CTNNBIP1; ICAT; Inhibitor of beta catenin and Tcf 4; Inhibitor of beta-catenin and Tcf-4; MGC15093
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
Expression Range 1-81aa
Protein Length Full Length
Mol. Weight 36.2kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway.
Subcellular Location Cytoplasm. Nucleus.
Protein Families CTNNBIP1 family
Database References

HGNC: 16913

OMIM: 607758

KEGG: hsa:56998

STRING: 9606.ENSP00000366466

UniGene: PMID: 29048651

  • Low PLD1 expression and high ICAT expression were significantly associated with increased survival in colorectal cancer patients. PMID: 28939743
  • The present work aims to investigate the relationship between the expression of AEG-1(astrocyte elevated gene-1), b-FGF(basic-fibroblast growth factor), beta-catenin, Ki-67, TNF-alpha (tumor necrosis factor-alfa) other prognostic parameters in DC (Ductal Carcinomas) and ductal intraepithelial neoplasm. We found a relationship between these factors. PMID: 26096243
  • Overexpression of ICAT promoted Caski cells' proliferation, arrested the cell cycle in the S phase and enhanced cell migration. Conclusion Overexpression of ICAT can promote the proliferation and migration of Caski cervical cancer cells. PMID: 27774943
  • Somatic mutation of beta-catenin (CTNNB1) is known to be crucial for Wilms tumor development in up to 15% of cases. PMID: 27679509
  • CTNNBIP1 expression correlated with longer overall survival in LAC patients. This study reveals that miR-214 plays a critical role in CSLC self-renewal and stemness by targeting CTNNBIP1. PMID: 26299367
  • Data show that microRNA miR-215 activates beta-catenin pathways by decreasing catenin beta interacting protein 1 (CTNNBIP1)expression in gliomas. PMID: 26317904
  • Simultaneous silencing of beta-catenin and STAT3 synergistically induces apoptosis and inhibits cell proliferation in HepG2 liver cancer cells. PMID: 25845340
  • Finally, pro-incubation with idebenone inhibited mitochondrial dysfunction induced by oxLDL through the mitochondrial-dependent apoptotic pathway and GSK3beta/beta-catenin signalling pathways. PMID: 26284974
  • A potent beta-catenin inhibitor, ICAT/CTNNBIP1 was a direct target of miR-424-5p. PMID: 25175916
  • Particulate matter (PM10) downregulates E-Cadherin/beta-Catenin expression. PMID: 26047787
  • A statistically significant lapatinib- and gefitinib-induced repression of cyclin D1, MMP9 and beta-catenin in CERV196 cells. PMID: 26124325
  • Nuclear YAP and cytoplasmic beta-catenin play important roles in carcinogenesis. PMID: 26124339
  • review of control of cell fate and proliferation in colon cancer PMID: 25193262
  • miR-603 regulates glioma development via Wnt-beta-cateninn signaling pathway and its WIF1 and CTNNBIP1 targets. PMID: 25681036
  • These results indicate that beta-catenin translation is initiated via the IRES and this is regulated by PTX, suggesting that regulation of the IRES-dependent translation of beta-catenin may be involved in the cancer cell response to PTX treatment. PMID: 25849888
  • ICAT may serve as a tumor-suppressor in human glioma. PMID: 25434796
  • Suppressing TrpC5 expression decreased nuclear beta-catenin accumulation, reduced the induction of ABCB1, and reversed 5-fluorouracil neoplastic resistance. PMID: 25404731
  • Our results indicate that HDAC1 plays an important role in chondrogenesis and may represent a therapeutic target for modulation of cartilage development. PMID: 25445594
  • ASPP2 prevents beta-catenin from transactivating ZEB1 directly by forming an ASPP2-beta-catenin-E-cadherin ternary complex PMID: 25344754
  • It involved in the control of cell growth, differentiation, and apoptosis. PMID: 24390805
  • PTHrP was found to inhibit DKK1 expression through c-Jun-mediated inhibition of beta-catenin activity on the DKK1 promoter. PMID: 23752183
  • beta-catenin inhibitor ICAT modulates the invasive motility of melanoma cells. PMID: 24514042
  • Neither cyclin D1 nor beta-catenin was expressed in a statistically significant manner, concluding that the development of MCCs is independent of beta-catenin and cyclin D1 expression and these proteins are not suitable as prognostic markers. PMID: 23928935
  • beta-catenin is delocalized and survivin is over-expressed in recurrent sporadic and nevoid basal cell carcinoma syndrome-associated keratocystic odontogenic tumor PMID: 23572266
  • Thus, our results indicated abnormal expression of CD44V6, CDH11, and beta-catenin in osteosarcomas and osteochondromas, which may provide important indicators for further research. PMID: 23971040
  • The data show that Snail1 and beta-catenin, besides association with loss of hormone dependence, protect cancer cells from hypoxia and may serve as an important target in the treatment of breast cancer. PMID: 23973669
  • This study demonistrated that mean protein and mRNA levels of beta-catenin were significantly decreased in both the PFC and hippocampus of teenage suicide group compared to controls. PMID: 23110823
  • beta-catenin accumulation in the nucleus regulates expression of Nanog protein and has a role in progression of non-small cell lung cancer PMID: 23648139
  • These findings suggest that Sphingosine-1-phosphate activates signaling leading to nuclear translocation of beta-catenin in osteoblast-like cells and upregulation of osteoptotegerin and osteoblast differentiation markers PMID: 23612487
  • beta-catenin was significantly associated with nodal stage, TNM stage, and E-cadherin expression. beta-catenin could be early marker for identification of occult metastases in oral SCC. PMID: 22525043
  • In this review, we will discuss the points of intersection between the Wnt/beta-catenin and Hippo/YAP pathways and how these interactions contribute to homeostasis, organ repair, and tumorigenesis. PMID: 23027379
  • ICAT is a novel Ptf1a interactor that regulates pancreatic acinar differentiation and displays altered expression. PMID: 23339455
  • our data clearly identify protein stabilizing mutations of the beta-catenin gene as a common feature of nested stromal epithelial tumors of the liver, similarly as in hepatoblastomas. PMID: 22749188
  • Microatellite-stable cases exhibited reduced membranous beta catenin and increased cytoplasmic and nuclear beta catenin compared with microsatellite-instable cases. PMID: 21791486
  • Airway basal cell beta-catenin determines cell fate and its mis-expression is associated with the development of human lung cancer. PMID: 22081448
  • Cholangiocarcinoma cell lines express E-cad and beta-cat but with different localizat- ion patterns. PMID: 22075503
  • Inhibitor of beta-catenin and T-cell factor (ICAT), a beta-catenin binding protein that inhibits the canonical Wnt/beta-catenin signaling pathway, in AR signaling, was investigated. PMID: 21885566
  • Reduced/aberrant beta-catenin expression was seen in benign and malignant salivary gland tumors. PMID: 20034989
  • ICAT is a direct transcriptional target of E2F1, and activation of ICAT by E2F1 is required for E2F1 to inhibit beta-catenin activity. PMID: 21532622
  • overexpression of beta-catenin may be an important contributing factor to glioma progression. PMID: 20300972
  • High beta-catenin is associated with glioma progression. PMID: 21636708
  • LMP1 may be involved in nasopharyngeal carcinogenesis via beta-catenin signaling pathway PMID: 21336584
  • A coactivator role of CARM1 in the dysregulation of beta-catenin activity in colorectal cancer cell growth and gene expression PMID: 21478268
  • When both E-cadherin and beta -catenin expressions were reduced, there was a significant unfavourable prognosis. PMID: 21574102
  • The protein expression levels of Wnt1, beta-catenin and Cyclin D1 were all positively correlated with the Karnofsky performance scale (KPS) score and World Health Organization (WHO) grades of patients with gliomas. PMID: 20809334
  • beta-catenin is expressed in actinic chelitis and squamous cell carcinoma of the lip PMID: 20970365
  • Data show that elevated beta-catenin expression level may be an adverse indicator for the prognosis of ESCC patients at stage T2-3N0M0, especially for those with T3 lesions or stage IIB diseases. PMID: 21049553
  • cytoplasmic accumulation of beta-catenin can induce Tcf/Lef-mediated transcriptional activity, up-regulate MMP-7, and induce epithelial and mesenchymal transition (EMT). PMID: 20878057
  • our results support the concept that STAT3 upregulates the protein expression and transcriptional activity of beta-catenin in breast cancer. PMID: 20830236
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed