Recombinant Human beta Actin/ACTB Protein
Beta LifeScience
SKU/CAT #: BLA-12361P
Recombinant Human beta Actin/ACTB Protein
Beta LifeScience
SKU/CAT #: BLA-12361P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Host Species | Human |
| Accession | P60709 |
| Synonym | A26C1A A26C1B ACTB ACTB_HUMAN Actin beta Actin cytoplasmic 1 Actin, cytoplasmic 1, N-terminally processed Actx b actin b-actin Beta cytoskeletal actin Beta-actin BRWS1 E430023M04Rik Melanoma X actin MGC128179 PS1TP5 binding protein 1 PS1TP5BP1 |
| Description | Recombinant Human beta Actin/ACTB Protein was expressed in Mammalian. It is a Full length protein |
| Source | Mammalian |
| AA Sequence | MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK DSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG IVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSF TTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITI GNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS TFQQMWISKQEYDESGPSIVHRKCF |
| Molecular Weight | 42 kDa |
| Purity | >85% SDS-PAGE. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
| Target Function | Actin is a highly conserved protein that polymerizes to produce filaments that form cross-linked networks in the cytoplasm of cells. Actin exists in both monomeric (G-actin) and polymeric (F-actin) forms, both forms playing key functions, such as cell motility and contraction. In addition to their role in the cytoplasmic cytoskeleton, G- and F-actin also localize in the nucleus, and regulate gene transcription and motility and repair of damaged DNA. |
| Subcellular Location | Cytoplasm, cytoskeleton. Nucleus. |
| Protein Families | Actin family |
| Database References | HGNC: 132 OMIM: 102630 KEGG: hsa:60 STRING: 9606.ENSP00000349960 UniGene: PMID: 28194011 |
