Recombinant Human Beta-1 Adrenergic Receptor (ADRB1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10667P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Beta-1 Adrenergic Receptor (ADRB1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10667P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Beta-1 Adrenergic Receptor (ADRB1) Protein (His) is produced by our Yeast expression system. This is a cytoplasmic protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P08588 |
| Target Symbol | ADRB1 |
| Synonyms | ADRB1; ADRB1R; B1AR; Beta-1 adrenergic receptor; Beta-1 adrenoreceptor; Beta-1 adrenoceptor |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV |
| Expression Range | 378-477aa |
| Protein Length | Cytoplasmic Domain |
| Mol. Weight | 12.5kDa |
| Research Area | Cardiovascular |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling. Involved in the regulation of sleep/wake behaviors. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. Early endosome. |
| Protein Families | G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily |
| Database References | HGNC: 285 OMIM: 109630 KEGG: hsa:153 STRING: 9606.ENSP00000358301 UniGene: PMID: 29514624 |
