Recombinant Human Bax Protein
Beta LifeScience
SKU/CAT #: BLA-2920P
Recombinant Human Bax Protein
Beta LifeScience
SKU/CAT #: BLA-2920P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q07812 |
Synonym | Apoptosis regulator BAX BAX Bax-protein BAX_HUMAN BAXA Baxdelta2G9 Baxdelta2G9omega Baxdelta2omega Bcl-2-like protein 4 BCL2 associated X protein BCL2 associated X protein omega BCL2 associated X protein transcript variant delta2 Bcl2-L-4 BCL2L4 membrane isoform alpha |
Description | Recombinant Human Bax Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGF IQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVP ELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHH |
Molecular Weight | 22 kDa including tags |
Purity | >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |