Recombinant Human Basic Fibroblast Growth Factor (FGF2), Active, GMP

Recombinant Human Basic Fibroblast Growth Factor (FGF2), Active, GMP
Collections: Buy cytokines, chemokines, and growth factors for research online, Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Kinase, Recombinant fibroblast growth factor basic (fgfb/fgf2/bfgf) proteins
Product Overview
Description | Recombinant Human Basic Fibroblast Growth Factor (FGF2), Active, GMP is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 98% as determined by SDS-PAGE and HPLC. |
Endotoxin | Less than 0.01 EU/μg of rHubFGF GMP as determined by LAL method. |
Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 107 IU/mg. |
Uniprotkb | P09038 |
Target Symbol | FGF2 |
Synonyms | Basic fibroblast growth factor; Basic fibroblast growth factor bFGF; BFGF; FGF 2; FGF B; FGF-2; Fgf2; FGF2 basic; FGF2_HUMAN; FGFB; Fibroblast growth factor 2 (basic); Fibroblast growth factor 2; Fibroblast growth factor; basic; HBGF 2; HBGF-2; HBGF2; HBGH 2; HBGH2; Heparin binding growth factor 2 precursor; Heparin-binding growth factor 2; Prostatropin |
Species | Homo sapiens (Human) |
Expression System | E.Coli |
Tag | Tag-Free |
Complete Sequence | M+PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Expression Range | 143-288aa |
Protein Length | Partial |
Mol. Weight | 16.5 kDa |
Research Area | Signal Transduction |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 µm filtered concentrated solution in 20 mM Tris-HCl, pH 7.6, with 150mM NaCl. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation. |
Subcellular Location | Secreted. Nucleus. |
Protein Families | Heparin-binding growth factors family |
Database References | HGNC: 3676 OMIM: 134920 KEGG: hsa:2247 STRING: 9606.ENSP00000264498 UniGene: PMID: 29989583 |