Recombinant Human B7-H4 Protein (Biotin)
Beta LifeScience
SKU/CAT #: BLA-10588P
Recombinant Human B7-H4 Protein (Biotin)
Beta LifeScience
SKU/CAT #: BLA-10588P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q7K480 |
Synonym | B7 family member, H4 B7 H4 B7 homolog 4 B7 superfamily member 1 B7 superfamily, member 1 B7-H4 B7h.5 B7h4 B7S1 B7x BC032925 Immune costimulatory protein B7-H4 Immune costimulatory protein B7H4 MGC41287 PRO1291 Protein B7S1 RP11 229A19.4 T cell costimulatory molecule B7x T-cell costimulatory molecule B7x V set domain-containing T cell activation inhibitor 1 V-set domain-containing T-cell activation inhibitor 1 VCTN1 Vtcn1 VTCN1_HUMAN |
Description | Recombinant Human B7-H4 Protein (Biotin) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLG LVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTY KCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPT VVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIE NDIAKATGDIKVTESEIKRRSHLQLLNSKAHHHHHHHHHHGGGLNDIFEA QKIEWHE |
Molecular Weight | 29 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |