Recombinant Human B-Cell Receptor Cd22 (CD22) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10974P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human B-Cell Receptor Cd22 (CD22) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10974P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human B-Cell Receptor Cd22 (CD22) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P20273 |
Target Symbol | CD22 |
Synonyms | B cell receptor CD22 precursor; B lymphocyte cell adhesion molecule; B-cell receptor CD22; B-lymphocyte cell adhesion molecule; BL CAM; BL-CAM; BLCAM; CD 22; CD22; CD22 antigen; CD22 molecule; CD22 protein; CD22_HUMAN; Lectin 2; Leu14; Lyb8; MGC130020; sialic acid binding Ig like lectin 2; Sialic acid binding immunoglobulin like lectin 2; Sialic acid-binding Ig-like lectin 2; SIGLEC 2; Siglec-2; SIGLEC2; T cell surface antigen Leu 14; T-cell surface antigen Leu-14 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | ESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPL |
Expression Range | 553-672aa |
Protein Length | Partial |
Mol. Weight | 26.3 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Protein Families | Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family |
Database References | HGNC: 1643 OMIM: 107266 KEGG: hsa:933 STRING: 9606.ENSP00000085219 UniGene: PMID: 28829594 |