Recombinant Human B-Cell Cll/Lymphoma 7 Protein Family Member A (BCL7A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06617P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human B-Cell Cll/Lymphoma 7 Protein Family Member A (BCL7A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06617P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human B-Cell Cll/Lymphoma 7 Protein Family Member A (BCL7A) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q4VC05 |
Target Symbol | BCL7A |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | C-6His |
Target Protein Sequence | MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM |
Expression Range | 1-210aa |
Protein Length | Full Length |
Mol. Weight | 24.3 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Protein Families | BCL7 family |
Database References | |
Associated Diseases | Chromosomal aberrations involving BCL7A may be a cause of B-cell non-Hodgkin lymphoma. Three-way translocation t(8;14;12)(q24.1;q32.3;q24.1) with MYC and with immunoglobulin gene regions. |
Gene Functions References
- BCL7A, BRWD3, and AUTS2 demonstrate significantly higher mutation frequencies among AA cases. These genes are all involved in translocations in B-cell malignancies. Moreover, we detected a significant difference in mutation frequency of TP53 and IRF4 with frequencies higher among CA cases. Our study provides rationale for interrogating diverse tumor cohorts to best understand tumor genomics across populations. PMID: 29166413
- Data suggest that BCL7A may play an important role in cutaneous T-cell lymphoma (CTCL) carcinogenesis. PMID: 22856870
- Report describes BCL7A protein expression in normal lymphoid tissues and lymphomas using immunohistochemistry. PMID: 23043359
- Promoter hypermethylation of BCL7a is associated with cutaneous T-cell lymphoma PMID: 15897551
- deletion of genes BCL7A in early-stage mycosis fungoides. PMID: 18663754
- Variants in BCL7A were strongly related to diffuse large B-cell lymphoma. PMID: 19336552