Recombinant Human B- And T-Lymphocyte Attenuator (BTLA) Protein (hFc-Myc), Active

Name: Recombinant Human B- And T-Lymphocyte Attenuator (BTLA) Protein (hFc-Myc), Active
Brand: Beta LifeScience
SKU: BLC-05868P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 μg/ml can bind biotinylated human TNFRSF14 , the EC 50 is 137.8-233.4 ng/ml. Biological Activity Assay

Collections: All products, Cluster of differentiation (cd) proteins, Co-inhibitory receptors, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality recombinant proteins, Immune checkpoint proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human B- And T-Lymphocyte Attenuator (BTLA) Protein (hFc-Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	1. Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 μg/ml can bind biotinylated human TNFRSF14 , the EC 50 is 137.8-233.4 ng/ml.
Uniprotkb	Q7Z6A9
Target Symbol	BTLA
Synonyms	(B- and T-lymphocyte-associated protein)(CD272)
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-hFc-Myc
Target Protein Sequence	KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Expression Range	31-150aa
Protein Length	Partial
Mol. Weight	43.9 kDa
Research Area	Cancer
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14. In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells.
Subcellular Location	Cell membrane; Single-pass type I membrane protein.
Database References	HGNC: 21087 OMIM: 607925 KEGG: hsa:151888 STRING: 9606.ENSP00000333919 UniGene: PMID: 29061848 our data suggested that the BTLA/HVEM pathway contributes to peripheral T cell suppression in hepatocellular carcinoma patients PMID: 30116751 data provide the first evidence that increased BTLA predicts poor prognosis in patients with diffuse large B-cell lymphoma (DLBCL), and blockade of BTLA with other checkpoints may potentially represent a new strategy for immunotherapy of DLBCL. PMID: 29353075 The genetic variants of rs76844316 in BTLA influence the susceptibility to severe chronic hepatitis B and might play a protective role against the progression of chronic hepatitis B. PMID: 29558758 The impairment of Bregs and CD19+/BTLA+ cells could play an important pathogenic role in multiple sclerosis (MS). PMID: 27412504 Our data portrays BTLA as a molecule with the singular ability to provide both costimulatory and coinhibitory signals to activated CD8(+) T cells, resulting in extended survival, improved tumor control, and the development of a functional recall response. PMID: 28754817 results indicate that polymorphisms rs1982809 situated in 3' UTR nearby region of BTLA gene might be considered as low-penetrating risk factor for RCC, but results have to be confirmed in further studies PMID: 27234378 The percentage of circulating BTLA+CD4+ lymphocytes was significantly higher in patients with severe community acquired pneumonia. PMID: 28164546 Plasma concentrations of soluble BTLA were increased early in sepsis/septic shock and correlated to severity of disease. A baseline concentration >21ng/mL was associated with a poor prognosis. PMID: 28056053 this study shows that in chronic hepatitis B virus patients, a subset of inefficient interferon-gamma producing antigen-specific CD8+ T cells recruited to the liver expressed high BTLA levels PMID: 27743606 this study shows that BTLA expression is likely associated with positive rather than conventional negative regulation of CD11c antigen-presenting cell stimulatory capacity PMID: 27717503 rs1982809 BTLA gene polymorphism is associated with mRNA expression level and variations in the BTLA gene might be considered as potentially low-penetrating chronic lymphocytic leukemia risk factor PMID: 27933341 Study showed a decreased expression of BTLA in ocular Behcet's disease suggesting that it may be involved in the development and recurrence of this disease. PMID: 26841832 BTLA expression declines on B cells of the aged and is associated with low responsiveness to the trivalent influenza vaccine. PMID: 26277622 our study confirms that CD200/BTLA deletions are recurrent genetic lesions in the biology of BCP-ALL PMID: 26137961 Focal deletions of the BTLA were associated with B-cell precursor acute lymphoblastic leukemia. PMID: 25261097 high BTLA expression levels in gastric cancer, identified by IHC, are an independent biomarker for the poor prognosis of patients with gastric cancer. PMID: 25334051 Data indicate taht lung function and the expressions of B, T lymphocyte attenuator (BTLA) and Treg cells were lower in patients with rheumatism than those in normal controls. PMID: 24909289 BTLA is a coreceptor that negatively regulates human Vgamma9Vdelta2 T-cell proliferation and has a role in immune escape for lymphoma cells PMID: 23692853 BTLA and HVEM may have roles in graft rejection after kidney transplantation PMID: 23375291 BTLA regulates human B cell responses and has implications for future development of therapies modulating B cells. PMID: 22903545 The expression of BTLA has been observed on the surface of several kinds of cells within synovial tissues of RA patients, which indicates this signal might be involved in the regulation of local T cell activation and the pathogenesis of RA. PMID: 22691359 These findings support role for BTLA and/or HVEM as potential, novel diagnostic markers of innate immune response/status and as therapeutic targets of sepsis. PMID: 22459947 study described the expression and spatial distribution of HVEM and BTLA in rheumatoid arthritis synovial tissues, and results indicated that HVEM/BTLA may be involved in regulating the progress of joint inflammation PMID: 22179929 BTLA-HVEM interactions impair minor histocompatibiility antigen-specific T cell functionality, providing a rationale for BTLA signaling blockade in post-stem cell transplantation. PMID: 22634623 Added with PD-1 and Tim-3 blockades, BTLA blockade enhanced the expansion, proliferation, and cytokine production of NY-ESO-1-specific CD8(+) T cells. PMID: 22205715 HVEM-BTLA cis complex provides intrinsic regulation in T cells serving as an interference mechanism silencing signals coming from the microenvironment. PMID: 21920726 The results of a mutagenesis study of HVEM suggest that the CD160 binding region on HVEM was slightly different from, but overlapped with, the BTLA binding site. PMID: 21959263 590C single-nucleotide polymorphism of B- and T-lymphocyte attenuator was significantly associated with susceptibility to rheumatoid arthritis, but not to systemic lupus erythematosus or Sjogren's syndrome. PMID: 21403914 BTLA expression on overall CD4(+) and CD8(+) T cells was progressively decreased in HIV-1 infection, which was directly correlated with disease progression and CD4(+) T-cell differentiation and activation PMID: 21592997 In vitro blockade of the BTLA pathway augments allogeneic as well as cytomegalovirus-specific CD8-positive T cell proliferation, thereby enhancing the functional capacity of cytotoxic T lymphocytes in viral infections. PMID: 20693422 BTLA gene polymorphisms may affect the sporadic breast cancer risk and prognosis in Chinese women in northeast of Heilongjiang Province PMID: 19585237 Binding of HVEM to BTLA attenuates T cell activation, identifying HVEM/BTLA as a coinhibitory receptor pair. PMID: 15647361 distinct herpesviruses target the HVEM-BTLA cosignaling pathway, suggesting the importance of this pathway in regulating T cell activation during host defenses. PMID: 16131544 2.8-A crystal structure of the BTLA-HVEM complex shows that BTLA binds the N-terminal cysteine-rich domain of HVEM and employs a unique binding surface PMID: 16169851 BTLA is constitutively expressed on most CD4+ and CD8+ T cells and its expression progressively decreases upon T cell activation. PMID: 16643847 Cross-linking of BTLA with mAb 7D7 suppressed T lymphocyte proliferation, downregulated the expression of T cell activation marker CD25, and inhibited the production of interferon (IFN)-gamma, interleukin (IL)-2, IL-4, and IL-10. PMID: 17257317 BTLA is an inhibitory coreceptor of the B cell receptor (BCR) signaling pathway that attenuates B cell activation by targeting the downstream signaling molecules Syk and B cell linker protein (BLNK). PMID: 19155498 this study did not find any genetic contribution of the BTLA gene to the development of T1D and SLE in Japanese population. PMID: 19207938 results suggest that down-regulation of the BTLA-HVEM pathway may be involved in germinal center B-cell activation. PMID: 19762537 the HVEM-BTLA cis-complex competitively inhibits HVEM activation by ligands expressed in the surrounding microenvironment, thus helping maintain T cells in the naive state. PMID: 19915044 HVEM binds to B T lymphocyte attenuator (BTLA), an Ig family member, which inhibits T cell proliferation. PMID: 15568026

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.