Recombinant Human Augurin (ECRG4) Protein (His&Myc)

Name: Recombinant Human Augurin (ECRG4) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-00210P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Augurin (ECRG4) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Activity	Not tested.
Uniprotkb	Q9H1Z8
Target Symbol	ECRG4
Synonyms	(Esophageal cancer-related gene 4 protein)(ECRG4)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPR
Expression Range	71-132aa
Protein Length	Partial
Mol. Weight	12.9 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Probable hormone that may attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system. ECRG4-induced senescence is characterized by G1 arrest, RB1 dephosphorylation and accelerated CCND1 and CCND3 proteasomal degradation.
Subcellular Location	Secreted. Cytoplasm. Apical cell membrane.
Protein Families	Augurin family
Database References	HGNC: 24642 OMIM: 611752 KEGG: hsa:84417 UniGene: PMID: 28578429 mutations in Pakistani patients with dilated cardiomyopathy rs375563861 (C2orf40), rs143187236 (MYOM3), and rs564181443 (RTKN2) have 3 fold or higher allele frequency in South Asians than in the global populations PMID: 29886034 ECRG4 down-regulates UBE2C expression in esophageal squamous cell carcinoma cells. PMID: 29268240 Results from many studies support the discovery that ECRG4 plays a critical role in the pathogenesis of atrial fibrillation. [review] PMID: 29126922 UBR5 directly binds to the tumor suppressor esophageal cancer-related gene 4, increasing its ubiquitination to reducing the protein stability of ECRG4 to promote colorectal cancer progression. PMID: 28856538 positive and negative regulatory elements controlling ECRG4 expression include a counter regulation between promoter methylation and Sp1 activation. PMID: 28870864 the overexpression of Beclin 1 promoted apoptosis and decreased invasion by upregulating the expression of ECRG4 in A549 lung adenocarcinoma cells. Therefore, the selection of Beclin l as a target for gene therapy represents a more effective method for the treatment of lung cancer. PMID: 27175789 Downregulated ECRG4 is correlated with lymph node metastasis in nasopharyngeal carcinoma PMID: 27119734 The overexpression of ECRG4 inhibited tumorigenesis. PMID: 26762416 ECRG4 may be a tumor suppressor in renal cancer and serve as a prognostic marker PMID: 26276361 low expression or no expression of ECRG4 in esophageal cancer tissues was closely related to the degree of tumor invasion level, TNM staging, lymph node metastasis and recurrence and survival after surgery. PMID: 26823803 loss of ECRG4 protein expression may be involved in tumor progression and may serve as a prognostic biomarker for breast cancer. PMID: 26631111 Overexpression of ECRG4 inhibited laryngeal cancer cell proliferation and induced cancer cell apoptosis. PMID: 26165988 Our data suggest that methylation-mediated suppression of the ECRG4 gene occurs frequently in nasopharyngeal carcinoma PMID: 25707757 Results identify Ecrg4 as a paracrine factor that activates microglia and is chemotactic for monocytes, with potential as an antitumor therapeutic. PMID: 25378632 ECRG4 is present on the surface of human monocytes and granulocytes and its interaction with the innate immunity receptor complex supports a role for cell surface activation of ECRG4 during inflammation PMID: 25511108 The expression of ECRG4 is frequently upregulated in a papillary thyroid carcinoma through the demethylation mechanism of CpG islands in the gene promoter region, and the ECRG4 has a tumor-promoting function through inducing the cell cycle transition PMID: 25326809 ECRG4 is a candidate tumor suppressor gene that might be involved in the proliferation of esophageal squamous cell carcinoma PMID: 23957914 results suggest that C2ORF40 acts as a tumor suppressor gene in breast cancer pathogenesis and progression and is a candidate prognostic marker for this disease PMID: 23770814 overexpression of ECRG4 enhanced the chemosensitivity of gastric cancer SGC-7901 cells to 5-FU through induction of apoptosis. PMID: 23553029 Aberrant DNA methylation of ECRG4 gene is associated with colorectal cancer. PMID: 22901147 Aberrant ECRG4 promoter methylation may be used to monitor early gastric cancer and predict pathological staging. PMID: 22626786 DNA methylation of the ECRG4 promoter causes loss of ECRG4 gene expression in the esophageal squamous cell carcinoma cell line EC9706. PMID: 22325214 kDa Ecrg4 localizes to the cell surface of prostate (PC3) or kidney (HEK) epithelial cells after transfection. PMID: 22526622 Tumor necrosis factor-alpha-induced apoptosis was also suppressed in ECRG4-overexpressing Jurkat cells. PMID: 22411956 ECRG4 is a candidate tumor suppressor gene in breast cancer PMID: 22110708 Augurin would play a constitutive inhibitory function in normal CNS while down regulation of Ecrg4 gene expression in injury, like in cancer, dysinhibits proliferation. PMID: 21935431 Data show that ECRG4 interacts directly with ECRG1 to upregulate p21 protein expression, induce cell cycle G1 phase block and inhibit cancer cells proliferation in ESCC. PMID: 21288367 Loss of ECRG4 is associated with glioma. PMID: 20598162 ECRG4 is silenced via promoter hypermethylation in different types of human cancer cells. PMID: 20017917 Inactivation of ECRG 4 gene by hypermethylation is a frequent molecular event in esophageal squamous cell carcinoma and may be involved in the carcinogenesis of this cancer. PMID: 12800218 Significantly lower expression of esophageal cancer-related gene 4 is associated with esophageal squamous cell carcinoma PMID: 17786363 The restoration of ECRG4 expression in ESCC cells inhibited cell proliferation, colony formation, cell cycle progression and tumor growth in vivo. ECRG4 is a novel candidate tumor suppressor gene in ESCC. PMID: 19521989

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.