Recombinant Human Atrial Natriuretic Peptide-Converting Enzyme (CORIN) Protein (His)

Beta LifeScience SKU/CAT #: BLC-01105P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Atrial Natriuretic Peptide-Converting Enzyme (CORIN) Protein (His)

Beta LifeScience SKU/CAT #: BLC-01105P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Atrial Natriuretic Peptide-Converting Enzyme (CORIN) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q9Y5Q5
Target Symbol CORIN
Synonyms (Corin)(Heart-specific serine proteinase ATC2)(Pro-ANP-converting enzyme)(Transmembrane protease serine 10)
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS
Expression Range 1-110aa
Protein Length Partial
Mol. Weight 16.0 kDa
Research Area Cardiovascular
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Serine-type endopeptidase involved in atrial natriuretic peptide (NPPA) and brain natriuretic peptide (NPPB) processing. Converts through proteolytic cleavage the non-functional propeptides NPPA and NPPB into their active hormones, ANP and BNP(1-32) respectively, thereby regulating blood pressure in the heart and promoting natriuresis, diuresis and vasodilation. Proteolytic cleavage of pro-NPPA also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Also acts as a regulator of sodium reabsorption in kidney.; has weaker endopeptidase activity compared to isoform 1.
Subcellular Location Cell membrane; Single-pass type II membrane protein. Note=May easily detached from the endothelial cell membrane.; [Isoform 2]: Cell membrane; Single-pass type II membrane protein. Note=Less efficiently targeted to the cell membrane compared to isoform 1.; [Atrial natriuretic peptide-converting enzyme, 180 kDa soluble fragment]: Secreted. Note=Soluble form produced following cleavage by ADAM10.; [Atrial natriuretic peptide-converting enzyme, 160 kDa soluble fragment]: Secreted. Note=Soluble form produced following autocatalytic cleavage.; [Atrial natriuretic peptide-converting enzyme, 100 kDa soluble fragment]: Secreted. Note=Soluble form produced following autocatalytic cleavage.
Protein Families Peptidase S1 family
Database References

HGNC: 19012

OMIM: 605236

KEGG: hsa:10699

STRING: 9606.ENSP00000273857

UniGene: PMID: 29180304

  • Suggest that pro-ANP/corin/NPR-C signaling is dominant in the vascular system in preeclampsia. PMID: 29523263
  • These results indicate that genetic variants impairing corin function are not uncommon in general populations and that such variants may be an important contributing factor in hypertension. PMID: 28861913
  • Preeclampsia is one of the most severe complications of the pregnancy, and trials to estimate a panel of predictive markers are of big interest for multiple researches. Corin is a transmembrane serine protease, localized in the heart, which is converting pro-ANP in to active ANR. ANP is a hormone regulating salt hemostasis and arterial blood pressure. [review] PMID: 29370493
  • Corin is a key enzyme in the natriuretic peptide system. The latest findings indicate that corin-mediated ANP production may act in a tissue-specific manner to regulate cardiovascular and renal function. Corin defects may contribute to major diseases such as hypertension, heart failure, pre-eclampsia, and kidney disease. PMID: 27898523
  • association of 2 single nucleotide polymorphisms in CORIN (rs2271037 and rs3749585) with hypertension, as well as their potential interactions with some risk factors of hypertension in a Han population of northeastern China PMID: 29391274
  • We detected elevated serum corin levels in women with pre-eclampsia. Interestingly, the serum corin levels were also found to be elevated in pregnancies with a related disorder, unexplained fetal growth restriction without hypertension, suggesting that this phenomenon is not simply a response to maternal hypertension. PMID: 27871468
  • Corin and atrial natriuretic peptide A were most abundant in the proximal convoluted tubules and the medullary connecting ducts. PMID: 27343265
  • CORIN expression is significantly downregulated in human masticatory mucosa during wound healing PMID: 28005267
  • serum levels of corin are significantly decreased in acute myocardial infarction patients PMID: 26577631
  • Data show that both furin and brain type natriuretic peptide (BNP) were more sensitive than corin in predicting cardiovascular complications in type 2 diabetes mellitus (T2DM) patients. PMID: 26488448
  • Circulating corin concentrations are related to infarct size in patients after ST-segment elevation myocardial infarction PMID: 25981578
  • Hypertensive participants had an increased serum corin level compared to those without hypertension, suggesting that corin may play a role in the pathology of hypertension. PMID: 25663063
  • Serum soluble corin was significantly and positively associated with dyslipidemia PMID: 26344336
  • Plasma corin levels decreased significantly from preoperative concentrations after coronary artery bypass graft surgery. PMID: 25649697
  • corin may play an important role in the pathology of atrial fibrillation PMID: 26048191
  • Increased serum soluble corin in mid pregnancy was associated with an increased risk for HDP(hypertensive disorders of pregnancy) .--increased serum soluble corin in mid pregnancy could be an indicator for HDP PMID: 26086065
  • identified a PCSK6 mutation that impaired corin activation activity in a hypertensive patient PMID: 26259032
  • the variant altered corin structure and impaired the natriuretic peptide processing activity in vivo. The results highlight corin defects as an important underlying mechanism in hypertension. PMID: 25488193
  • IRE1-dependent corin mRNA decay is a mechanism leading to corin protein deficiency may contribute to the pathophysiology of impaired natriuretic peptide pro-hormone processing in humans processing in humans with advanced systolic heart failure. PMID: 25516437
  • Serum soluble corin was decreased in patients with stroke compared with healthy controls. PMID: 26022632
  • In conclusion, this is the first report of a highly significant association between these two single nucleotide polymorphisms in CORIN gene and preeclampsia. PMID: 25474356
  • N-glycans at different sites may play distinct roles in regulating the cell membrane targeting, zymogen activation, and ectodomain shedding of corin PMID: 25451932
  • data provide important insights into the molecular basis underlying corin mutations that may contribute to preeclampsia in patients. PMID: 24828501
  • Corin mediates an essential step in the cascade of natriuretic peptide biosynthesis and eventually their action. Thus, it is postulated that aberrations in the normal activity of corin may contribute to cardiovascular and renal diseases. PMID: 24100222
  • CORIN is expressed in non-pregnant late secretory phase endometrium, first trimester human implantation sites and is up-regulated with decidualization ex vivo PMID: 23434834
  • The processing of proBNP1_108 by corin may be controlled by O-linked glycosylation of proBNP1-108. A potential impairment of proBNP1lo8 processing in heart failure may be linked to dysregulation of the convertase corin.[Review] PMID: 24015598
  • human CORIN gene mutations causing impaired corin activity may be an underlying mechanism in hypertension PMID: 23372161
  • The results indicate that renal tubular corin may be shed into urine and that urinary and renal corin levels were reduced in chronic kidney disease patients. PMID: 23327554
  • Results indicate that corin defects may represent an important mechanism in salt-sensitive hypertension and cardiac hypertrophy in blacks. PMID: 22987923
  • results indicate that corin and ANP are essential for physiological changes at the maternal-fetal interface, suggesting that defects in corin and ANP function may contribute to pre-eclampsia PMID: 22437503
  • the function and regulation of corin PMID: 22093942
  • the sequence in the cytoplasmic tail plays an important role in corin cell surface targeting and zymogen activation. PMID: 21518754
  • Ectodomain shedding and autocleavage of the cardiac membrane protease corin. PMID: 21288900
  • Data suggest that there may be patients for whom low corin levels and impaired pro-ANP cleavage contribute to acute decompensated heart failure. PMID: 21216831
  • A modest correlation is demonstrated between plasma corin levels and individual echocardiographic indices of cardiac hypertrophy, but no relationships between plasma corin and myocardial performance are proved in this study. PMID: 20670840
  • corin might be involved in the salt retention seen in glomerular diseases. PMID: 20613715
  • Insufficient corin activation is expected to prevent natriuretic peptide processing and may contribute to body fluid retention and impaired cardiac function in patients with heart failure. PMID: 20802129
  • Processing of pro-atrial natriuretic peptide by corin in cardiac myocytes. PMID: 11884416
  • These data indicate that the GATA element and its binding to GATA-4 are essential for cardiac expression of the human and murine corin genes. PMID: 12154094
  • the transmembrane domain is not necessary for the biological activity of corin but may be a mechanism to localize corin at specific sites PMID: 14559895
  • in CORIN, the frizzled 1 domain and LDLR repeats 1-4 are important structural elements for recognition of the physiological substrate, pro-ANP PMID: 15192093
  • The corin I555 (P568) allele is common in blacks and is associated with higher blood pressure and an increased risk for prevalent hypertension. PMID: 16216958
  • Corin I555(P568) allele represents a cardiac hypertrophy-sensitizing genetic locus in systemic hypertension. PMID: 17296875
  • N-linked oligosaccharides play an important role in corin activation PMID: 17660514
  • ANP and corin are expressed at the mRNA level in human adipose tissue and preadipocytes PMID: 17890485
  • corin gene single nucleotide polymorphism associated with hypertension and cardiac hypertrophy impair corin zymogen activation and natriuretic peptide processing activity PMID: 18669922
  • Dysfunctional corin i555(p568) allele is associated with impaired brain natriuretic peptide processing and adverse outcomes in blacks with systolic heart failure: results from the Genetic Risk Assessment in Heart Failure substudy. PMID: 19919978

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Sale
    SDS-PAGE analysis of Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein, CAT# BLT-08014P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein
    • Molecule: CEBPB;
    • Species: Mouse;
    • Expression system: E.coli;
    • Tag: N-His-GST;
    • Sequence: 1-296aa;
    CAT#: BLT-08014P

    Save $50
    Sale
    SDS-PAGE analysis of Human BAX (Apoptosis Regulator Bax) - Recombinant Protein, CAT# BLT-07419P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human BAX (Apoptosis Regulator Bax) - Recombinant Protein
    • Molecule: BAX;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-171aa;
    CAT#: BLT-07419P

    Save $50
    Recently viewed