Recombinant Human Atp Synthase Subunitd, Mitochondrial (ATP5H) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09104P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Atp Synthase Subunitd, Mitochondrial (ATP5H) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09104P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Atp Synthase Subunitd, Mitochondrial (ATP5H) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O75947 |
Target Symbol | ATP5H |
Synonyms | ATP synthase D chain mitochondrial; ATP synthase H+ transporting mitochondrial F1F0 subunit; ATP synthase H+ transporting mitochondrial F1F0 subunit d; ATP synthase subunit d; ATP synthase subunit d; mitochondrial; ATP synthase; H+ transporting; mitochondrial F0 complex; subunit d; ATP5H; ATP5H_HUMAN; ATP5JD; ATPase subunit d; ATPQ; mitochondrial; My032 protein |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | AGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL |
Expression Range | 1-161aa |
Protein Length | Full Length |
Mol. Weight | 45.4kDa |
Research Area | Tags & Cell Markers |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements. |
Subcellular Location | Mitochondrion. Mitochondrion inner membrane. |
Protein Families | ATPase d subunit family |
Database References | HGNC: 845 KEGG: hsa:10476 STRING: 9606.ENSP00000301587 UniGene: PMID: 28242297 |