Recombinant Human Atp-Dependent Translocase Abcb1 (ABCB1) Protein (His)

Name: Recombinant Human Atp-Dependent Translocase Abcb1 (ABCB1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03566P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ABCB1.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Atp-Dependent Translocase Abcb1 (ABCB1) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P08183
Target Symbol	ABCB1
Synonyms	ABC20; ABCB1; ATP binding cassette, sub family B (MDR/TAP), member 1; ATP-binding cassette sub-family B member 1; CD243; CLCS; Colchicin sensitivity; Doxorubicin resistance; GP170; MDR1; MDR1_HUMAN; Multidrug resistance 1; Multidrug resistance protein 1; P glycoprotein 1; P gp; P-glycoprotein 1; PGY1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI
Expression Range	236-297aa
Protein Length	Partial
Mol. Weight	10.8kDa
Research Area	Transport
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Translocates drugs and phospholipids across the membrane. Catalyzes the flop of phospholipids from the cytoplasmic to the exoplasmic leaflet of the apical membrane. Participates mainly to the flop of phosphatidylcholine, phosphatidylethanolamine, beta-D-glucosylceramides and sphingomyelins. Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Apical cell membrane.
Protein Families	ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily
Database References	HGNC: 40 OMIM: 171050 KEGG: hsa:5243 STRING: 9606.ENSP00000265724 UniGene: PMID: 29511086 Study demonstrated that TWIST protein expression was elevated in liver cancer tissue specimens and was positively correlated with MDR1 expression. Knockdown of TWIST increased the sensitivity of RHepG2 cells to antineoplastic agents through a reduction in MDR1 expression and drug efflux ability. PMID: 30066890 the over-expression of SLC7A11, or supplementation with sufficiently cystine, or treatment with N-acetylcysteine significantly decreased P-gp expression and activity. It was suggested that ROS and SLC7A11/cystine were the two relevant factors responsible for the expression and function of P-gp, and that SLC7A11 might be a potential target modulating ADR resistance. PMID: 28630426 Data provide a mechanistic explanation for the differential effects of ABCB1 haplotypes on its promoter activity and underscore the importance of evaluating genetic variants in the context of haplotypes rather than individual SNPs when investigating their effects on gene/protein expression and disease risk. PMID: 30277801 CYP3A5, ABCB1 and two POR genotypes were assessed by real-time PCR. PMID: 28094348 ABCB1 C3435T polymorphism can affect the elimination of some antipsychotic/antidepressant drugs. PMID: 29723928 High BCL11A and MDR1 expression was associated with a poor response to chemotherapy. PMID: 29469608 The methylation/expression ratios of ABCB1 were unaffected by increasing BMI values. PMID: 27897267 Neither the ABCB1 C3435T nor the SLCO1B1 T521C polymorphism affected edoxaban PK. PMID: 27897269 Our results show that ABCB1 C3435T polymorphism may modulate serum THC levels in chronic heavy cannabis users. The exact mechanisms and roles that this may play in cannabis dependence genesis and evolution remain to be elucidated. These results should be controlled in a replication study using a larger population. PMID: 28917442 MDR1 is not expressed on erythrocyte membrane. PMID: 29098941 The genetic polymorphisms of the multi-drug resistance-1 (MDR-1) and human cytochrome P450 3A (CYP3A4 and CYP3A5) genes were analyzed and compared between steroid sensitive, steroid resistant and control groups. PMID: 30143489 This meta-analysis suggests that the MDR1 C > T polymorphism was not associated with the risk of MM. To confirm these findings, further comprehensive and well-designed studies are needed. PMID: 29495954 High MDR1 expression is associated with chemoresistance in ovarian cancer. PMID: 29956807 13-cis-retinoic acid, retinol and retinyl-acetate inhibited the Pgp and ABCG2 mediated substrate transport as well as the substrate stimulated ATPase activity of these transporters. PMID: 28145501 Haplotype analysis of ABCB1 conducted in patients with bullous pemphigoid demonstrated that the 1236T-2677G-3435T haplotype may protect against development of disease. PMID: 29948283 High ABCB1 expression is associated with Bendamustine-resistance in Mantle Cell Lymphoma. PMID: 29695404 Data show that multidrug resistance gene 1 (MDR1) expression was associated with worsen survival of esophageal squamous cell carcinoma (ESCC) patients with cisplatin-based chemotherapy. PMID: 29107111 ABCB1 variation affected myelosuppression, progression-free survival and overall survival in ovarian cancer patients who were treated with paclitaxel and carboplatin PMID: 29504705 Our data showed that the expression of the MDR1 gene was significantly higher in malignant tissue than in the normal tissues of patients with STS. In addition, high MDR1 expression was significantly associated with local advances, as well as poor response to treatment. PMID: 29689707 These results indicated that MG132 reversed the MDR of hypopharyngeal carcinoma by downregulating Pgp/Pgp, and the underlying mechanism may be associated with the activation the of the JNK signaling pathway PMID: 29901180 P-glycoprotein on peripheral blood leukocytes of systemic lupus erythematosus (SLE) patients with lupus arthritis may have a role in clinical response to methotrexate PMID: 28616661 This study elaborated a novel UCA1/miR-129/ABCB1 regulatory axis underlying paclitaxel resistance of ovarian cancer cells. PMID: 29777711 ABCB1 3435C>T and ATIC 347C>G SNPs were associated with abnormal hepatic enzyme elevation by methotrexate treatment in patients with rheumatoid arthritis. PMID: 29252093 The role of multidrug resistance 1 gene (MDR1 or ABCB1) polymorphism G2677T was studied in relation to paroxetine therapeutic efficacy and its side effects, as well as its association with selected demographic and clinical characteristics of patients with depressive disorder. PMID: 29754150 alterations in latrophilin expression occur in AML cells expressing P-gp PMID: 29938681 This study demonstrated that the The G2677T T and C3435T T alleles as well as the TT, CTT and TTT haplotypes seemed to be significantly associated with drug-resistance epilepsy in Tunisian epileptic population. PMID: 29198163 Pharmacokinetics of aripiprazole is affected by sex and ABCB1 gene phenotype PMID: 29325225 There were no significant differences in the bosutinib C0 between genotypes for ABCB1, ABCG2, and CYP3A4 polymorphisms. PMID: 29736778 Studies show a connection between UDP-glucose ceramide glucosyltransferase (UGCG) and multidrug resistance protein 1 (MDR1) overexpression and multidrug resistance development [Review]. PMID: 29409484 Due to the downregulation of MDR1 and MRP1, the intracellular accumulation of ADM was increased in the transfected cells compared with that in the parental K562/ADM cells..Our research revealed that protein expression of the ERK signaling pathway was inhibited by downregulating TRIB2, indicating that the ERK pathway was involved in cell drug resistance and proliferation. PMID: 29436678 Asiatic Acid strongly inhibited P-GP expression by blocking MDR1 gene transcription and increased the intracellular accumulation of the P-GP substrate Rhodamine 123 in MDR1-overexpressing cisplatin (DDP)-resistant lung cancer cells, A549/DDP. PMID: 29768255 Ceritinib enhanced the efficacy of substrate chemotherapeutic agent in ABCB1-overexpressing K562/adr leukemia cells both in vitro and in vivo models, but neither in sensitive parental K562 leukemia cells nor in ABCC1-overexpressing HL-60/adr leukemia cells. PMID: 29742496 Polymorphism of ABCB1 rs1045642-T variant allele is associated with colorectal cancer. PMID: 29282011 There is a certain correlation between the APC gene and ovarian tumors, and the APC gene mediates the apoptosis of tumor cells through the MDR-1/CLCX-1 signaling pathway. PMID: 29921377 ABCB1/Pgp expression, activity, and single nucleotide polymorphisms (SNPs) in chronic myeloid leukemia. [review] PMID: 29316665 High MDR1 expression is associated with primary myelodysplastic syndrome. PMID: 27605311 analysis of the structure of zosuquidar and UIC2-bound human-mouse chimeric ABCB1 PMID: 29440498 ABCB1 gene polymorphisms are not associated with response to chemotherapy in breast cancer. PMID: 29113667 Patients prescribed with short-term low-dose atorvastatin and carrying ABCB1 (rs1128503) or ABCG2 (rs2231142) SNPs did not show differences in LDL-C response (P>.05). PMID: 28833323 Genotypes of UGT1A and ABCB1 were significantly associated with changes in moxifloxacin pharmacokinetic parameters. PMID: 29210323 G2677T/A polymorphism of MDR1 may play a significant role in the development of drug-resistant epilepsy in the Polish patients PMID: 28608314 No association was found between the ABCB1 SNPs and Crohn's disease in the two populations PMID: 28759738 icaritin (ICT) decreased the mRNA and protein levels of multidrug resistance protein 1 (MDR1) in MG-63 doxorubicin-resistant (MG-63/DOX) cells. PMID: 29425587 We demonstrate for the first time that the effect of ABCB1 diplotype on tacrolimus disposition is dependent on both CYP3A5 and CYP3A4 genotype. PMID: 27378609 these results address key concerns in the field, including that of cross-resistance between taxanes and highlighting a mechanism of cabazitaxel resistance involving ABCB1 PMID: 28698198 CYP3A and ABCB1 SNPs were detected in 521 recipients. PMID: 28952408 MDR-1 C3435T gene polymorphism was associated with right ventricular dysfunction in patients with chronic obstructive pulmonary disease. PMID: 29791609 data suggested that hypomethylation agent decitabine restores drug sensitivity in the P-gp-induced MDR phenotype by depressing of P-gp activity as drug pump partly through MAPK signaling pathway. PMID: 28405849 None of the genotypes in ABCB1 1236 C>T, 2677 G>T/A, 3435 C>T, and 4036 A>G correlated with plasma dolutegravir concentration..The speculated peak level of plasma dolutegravir concentration was significantly higher in ABCG2 genetic variant holders, probably, at least in part, because of low expression levels of efflux transporters in the intestines associated with these genetic variants. PMID: 28858994

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.