Recombinant Human Arylamine N-Acetyltransferase 2 (NAT2) Protein (His-SUMO)

Name: Recombinant Human Arylamine N-Acetyltransferase 2 (NAT2) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-02898P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Arylamine N-Acetyltransferase 2 (NAT2) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P11245
Target Symbol	NAT2
Synonyms	AAC2; ARY2_HUMAN; Arylamide acetylase 2 (N-acetyltransferase 2, isoniazid inactivation); Arylamide acetylase 2; Arylamine N-acetyltransferase 2; HGNC:7646; N-acetyltransferase 2 (arylamine N-acetyltransferase); N-acetyltransferase type 2; NAT-2; NAT2; PNAT; Polymorphic arylamine N-acetyltransferase
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLVPKPGDGSLTI
Expression Range	1-290aa
Protein Length	Full Length
Mol. Weight	49.5kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
Subcellular Location	Cytoplasm.
Protein Families	Arylamine N-acetyltransferase family
Database References	HGNC: 7646 OMIM: 243400 KEGG: hsa:10 STRING: 9606.ENSP00000286479 UniGene: PMID: 30479108 It is concluded that the frequency of slow encoding NAT2 haplotype was high among Jordanian volunteers, which may have effects on drug responses and susceptibility to some diseases, such as cancers. PMID: 29173142 We report a high prevalence of NAT 2 slow acetylators in Ethiopians and a conditional NAT2 genotype-phenotype country-of-residence-based discordance implicating a partial phenotype conversion and metabolic adaptation. Gene-environment interactions regulate NAT2 phenotype. PMID: 29589062 NAT2 genetic variants are associated with urinary bladder cancer risk. PMID: 28577040 Letter: in bladder cancer ultra-slow acetylators with the NAT26A/6A genotype have a higher recurrence risk and a shorter recurrence-free time, especially among smokers. PMID: 28040354 NAT2 polymorphism is not associated with passive smoking associated breast cancer risk. PMID: 29071579 NAT2 role in the metabolic detoxification of heterocyclic aromatic amines PMID: 28160022 hydralazine efficacy and safety could be improved by NAT2 genotype-dependent dosing strategies PMID: 29018032 Studied the association between N-acetyl transferase 2 (NAT2)genetic polymorphisms, environmental factors and risk factors in colon or rectal cancer. PMID: 27883249 prevalence impaired glucose tolerance higher in obese children carrying the A803 allele PMID: 27481583 There were significant differences in NAT2(rs1799929, rs1799930) genotype or allele frequencies between the infertile and fertile groups and synergy effects of GSTP1 and NAT2 polymorphisms might lead to significant increase of infertility risk. PMID: 29505746 The increased risk of prostate cancer was observed among individuals with the NAT2 slow acetylator phenotype PMID: 29165164 Genotyping of TB patients from south India for NAT2 gene polymorphism revealed that 58 per cent of the study population comprised slow acetylators. Two-hour INH concentrations differed significantly among the three genotypes. PMID: 28574024 Slow NAT2 acetylators demonstrated a significant association with risk of anti-tuberculosis drug-induced liver injury in Thai patients. PMID: 27725049 The present study demonstrated no association between NAT2 genotype and drug-induced hepatotoxicity in the north Indian patients with tuberculosis. PMID: 28474630 SNP-inferred slow acetylation statuses were significantly associated with an approximately 50% decreased risk of bladder cancer PMID: 27223070 CYP3A4 expression and N-acetyl transferase 2 acetylator phenotype can better identify the patients with higher risk of adverse reactions and can facilitate the improvement of personalized clonazepam therapy and withdrawal regimen. PMID: 27639091 NAT2 genotypes are associated with N-acetylation phenotype variation. PMID: 28653770 NAT2 acetylator genotype has an important role in 4, 4'-methylene bis (2-chloroaniline) metabolism and suggest that risk assessments related to 4, 4'-methylene bis (2-chloroaniline) exposures consider accounting for NAT2 acetylator phenotype in the analysis PMID: 29180287 Review/Meta-analysis: NAT2 slow acetylation genotype is associated with an increased bladder cancer risk in Chinese individuals. PMID: 28182356 six selected NAT2 exonic single nucleotide polymorphisms were genotyped in an independent case-control sample of a Northern Chinese Han population to verify the possible association between NAT2 and schizophrenia. Three (rs1801280T/341C, rs1799930/G590A, and rs1208/A803G) of the six single nucleotide polymorphisms showed significant allele frequency differences between the case and the control groups. PMID: 28187106 Our findings suggested that NAT2 gene polymorphism rs1799931 was associated with decreased risk of acute myeloid leukemia and was likely to be a protective factor against acute myeloid leukemia development. PMID: 29049179 Study reestablished the association between NAT2 SA and isoniazid-induced liver injury in a Singaporean population and demonstrated its clinical validity in prediction of isoniazid-induced liver injury. PMID: 29036176 In non-syndromic cleft lip with or without cleft palate, we found a significant association between the EGF61 (rs4444903) and NSCL/P (P = .01) genes. Conversely, NAT2 (rs1799929) was not significantly different between the cases and the control group PMID: 28906376 182 Hungarian bladder cancer cases and 78 cancer-free controls were investigated. It was not possible to establish a particular impact of NAT26A and 7B genotypes (15 cases, 8%, 5 controls, 7%). GSTT1 exerted no marked influence on bladder cancer (negative 21% cases vs. 22% controls). The portion of GSTM1 negative bladder cancer patients was increased (63% cases vs. 54% controls). PMID: 28696897 Various antitubercular isoniazid dosing regimens have been proposed for NAT2-specific immunocompetent and immune-deficient patient populations. PMID: 27480867 Data suggest that metabolism (and possibly pharmacokinetics) of hypnotic nitrazepam involves liver enzymes AOX1 (aldehyde oxidase 1), NAT2 (N-acetyltransferase 2), AADAC (arylacetamide deacetylase), and CYP3A4 (cytochrome P450 3A4). PMID: 28606603 The multicolor melting curve assay described in our study is very promising for the efficient determination of NAT2 genotype, and can facilitate the personalized dosing of isoniazid PMID: 27377479 No significant differences in the acetylator NAT2 haplotype and phenotype distributions were found between Native American populations practicing farming and/or herding and those practicing hunting and gathering. PMID: 26503810 In any patient who may receive INH and happens to be NAT2 slow acetylator type, NAT2 genotype by covert action may influence the clinical response of above drugs. PMID: 27487996 Homozygous mutant allele of NAT2 gene at 481site may act as a predisposing factor for phenytoin intoxication among tuberculous meningitis or tuberculoma patients having seizures. PMID: 27488001 In the present study, we report that the most common NAT2 haplotype in the Korean population (TACGAGG; frequency = 47.6%) is associated with a low expression level of NAT2. We failed to find a significant relationship between rs4646241 and enzyme expression level. Haplotypes of Caucasian and African populations were markedly different from those of the Korean population. PMID: 27853051 We genotyped four selected variants of the NAT2 gene (NAT25, NAT26, NAT27, and NAT214) by Sanger sequencing. The majority of patients had NAT2 genotypes previously described as slow acetylators including NAT25/5, NAT25/6, NAT26/6, and NAT26/14 (78%) and none were genotyped as rapid acetylators. Controls were slow, intermediate, and rapid acetylators with frequencies of 72.39%, 21.48%, and 6.13%, respectively PMID: 27541622 this study confirms the significance of the association between slow-acetylator NAT2 variants and susceptibility to AT-DILI in an Indonesian population. PMID: 26911349 NAT2 gene variants were associated with antituberculosis drug-induced hepatotoxicity. PMID: 27104815 Single nucleotide polymorphism is associated with different N-acetyltransferase-2 acetylator phenotypes in wordwide population groups. PMID: 27136043 Association of NAT2 single nucleotide polymorphism and breast cancer risk with smoking in Japanese women PMID: 27068825 NAT2 slow acetylators have a higher risk of noncardiac gastric adenocarcinoma than intermediate and rapid acetylators have in a Taiwanese population. PMID: 26617241 NAT2 single nucleotide polymorphism associated with the risk bladder cancer development and interacts with smoking. PMID: 27495060 NAT2 gene polymorphisms (rs1041983 C/T, rs1801280 T/C, and rs1799930 G/A) in association with long-period active smoking could be the possible individual risk-predicting factors for breast cancer development in the population of Slovak women PMID: 26700672 Data on NAT2 gene polymorphisms obtained from the current meta-analysis do not support a major association with Parkinson's diease risk, except in Asian populations PMID: 27216438 Results show that NAT2 polymorphism was associated with increased risk of coronary heart disease in Chinese population. PMID: 26985933 NAT2 acetylation status and its single nucleotide polymorphisms in the Greenlandic population, including Inuit and European ancestry PMID: 25794903 Results showed that the NAT2 slow acetylation phenotypes are significantly associated with an increased risk of bladder cancer. PMID: 26585839 NAT2 slow acetylation state was associated with bladder cancer risk, and was shown to modestly increase the risk of bladder cancer. PMID: 26681036 the NAT2 slow acetylation genotypes might increase the susceptibility to pancreatic cancer in Europe but that these have no significant effects in the United States and multi-center populations. PMID: 26681215 Findings suggest that variations in the NAT2 gene and their interactions contribute to occupational diisocyanate asthma susceptibility. PMID: 26641831 The results suggest that NAT2 is related to cognitive processes dealing with distraction and attentional control in the auditory modality; ultra-slow acetylation status was associated with reduced higher cognitive functions PMID: 26615528 Individuals with NAT2 slow acetylators may have increased risk of antituberculosis drug-induced liver injury when standard dose of isoniazid was used. [META-ANALYSIS] PMID: 26616266 Findings support a role for NAT2 in modifying the association between red meat consumption and colorectal cancer in Japanese and African Americans. PMID: 26683305

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.