Recombinant Human Aquaporin-5 (AQP5) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-00149P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Aquaporin-5 (AQP5) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-00149P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Aquaporin-5 (AQP5) Protein (His-KSI) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Activity | Not tested. |
| Uniprotkb | P55064 |
| Target Symbol | AQP5 |
| Synonyms | (AQP-5) |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-KSI |
| Target Protein Sequence | LFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR |
| Expression Range | 225-265aa |
| Protein Length | Partial |
| Mol. Weight | 20.3 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Forms a water-specific channel. Plays an important role in fluid secretion in salivary glands. Required for TRPV4 activation by hypotonicity. Together with TRPV4, controls regulatory volume decrease in salivary epithelial cells. Seems to play a redundant role in water transport in the eye, lung and in sweat glands. |
| Subcellular Location | Apical cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. |
| Protein Families | MIP/aquaporin (TC 1.A.8) family |
| Database References | HGNC: 638 OMIM: 600231 KEGG: hsa:362 STRING: 9606.ENSP00000293599 UniGene: PMID: 29951954 |
