Recombinant Human Aquaporin-4 (AQP4) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02371P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Aquaporin-4 (AQP4) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02371P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Aquaporin-4 (AQP4) Protein (His-SUMO) is produced by our E.coli expression system. This is a cytoplasmic protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P55087 |
| Target Symbol | AQP4 |
| Synonyms | AQP 4; AQP-4; AQP4; AQP4_HUMAN; Aquaporin type 4; Aquaporin-4; Aquaporin4; HMIWC 2; HMIWC2; Mercurial insensitive water channel; Mercurial-insensitive water channel; MGC22454; MIWC; WCH 4; WCH4 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV |
| Expression Range | 253-323aa |
| Protein Length | Cytoplasmic Domain |
| Mol. Weight | 24.0kDa |
| Research Area | Transport |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Forms a water-specific channel. Plays an important role in brain water homeostasis and in glymphatic solute transport. Required for a normal rate of water exchange across the blood brain interface. Required for normal levels of cerebrospinal fluid influx into the brain cortex and parenchyma along paravascular spaces that surround penetrating arteries, and for normal drainage of interstitial fluid along paravenous drainage pathways. Thereby, it is required for normal clearance of solutes from the brain interstitial fluid, including soluble beta-amyloid peptides derived from APP. Plays a redundant role in urinary water homeostasis and urinary concentrating ability. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endosome membrane. Cell membrane, sarcolemma; Multi-pass membrane protein. Cell projection. |
| Protein Families | MIP/aquaporin (TC 1.A.8) family |
| Database References | HGNC: 637 OMIM: 600308 KEGG: hsa:361 STRING: 9606.ENSP00000372654 UniGene: PMID: 29479071 |
